PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A03852.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 395aa    MW: 43688.2 Da    PI: 6.9257
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A03852.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.34.1e-24235279145
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                     k r+rWtpeLHerFv+av++LGGsekAtPk++ ++mkv+gLt++h
  Pahal.A03852.1 235 KSRIRWTPELHERFVDAVNKLGGSEKATPKAVQKVMKVEGLTIYH 279
                     68******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-20233279IPR009057Homeodomain-like
SuperFamilySSF466891.27E-9234281IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-16235278IPR006447Myb domain, plants
PfamPF002497.7E-6239277IPR001005SANT/Myb domain
PfamPF143796.6E-15313355IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MNRLYNGTVP PCLSSAITVV PALSEVSFPR FAEQRSSYGE SKLPIRSDTM STCMLAPNFT  60
SGLHAINKSS NGKLCSGPYV TEPSDSDTQL LSTHSSLLCN SRPLMMDFPE VSEQISSNQE  120
QLLGLFDYPS SVGFPNPQNV TAFGQQVQDT IITDPNTRVG GVALQNEWFS SGSSMQLPKN  180
VGSAESVLKT VDARSATPAT PKSYPYCRTQ RSLPNPFNCD ELCTDNLPSS NSAPKSRIRW  240
TPELHERFVD AVNKLGGSEK ATPKAVQKVM KVEGLTIYHK YRTVQHRPES SDGQSSQTDE  300
VSTLQLKGTG NVEGLMAQIT LQKQLHEQLE IQRKLQLQVE EQSKYLEMII VKQNESLKKL  360
GALPGFQDRF LQVSDNKKER EEWTVCTHSA EHRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-21235287260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-21235287260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-21235287260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-21235287260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-21235287260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-21235287260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-21235287260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-21235287260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025812111.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X3
TrEMBLA0A3L6QGF20.0A0A3L6QGF2_PANMI; Uncharacterized protein
STRINGPavir.Aa00126.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54942526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.16e-45phosphate starvation response 1