PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A03557.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 383aa    MW: 41721.4 Da    PI: 8.1477
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A03557.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.2e-2589132144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  Pahal.A03557.1  89 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 132
                     79***************************************998 PP

2QLQ59.31.1e-201852236
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                    +FTa+Q+q+L++Q+l+yK+La+++P+Pp+L+ +++
  Pahal.A03557.1 18 PFTASQWQELEHQALIYKCLASGKPIPPYLMPPLR 52
                    9******************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.5E-111753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.3421853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-141850IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57389133IPR014977WRC domain
PfamPF088792.0E-2090132IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MMMMSGRAGG GAGAGRYPFT ASQWQELEHQ ALIYKCLASG KPIPPYLMPP LRRILDSALA  60
TSPSLVFPPQ PSLGWGCFGM GFSRKPDEDP EPGRCRRTDG KKWRCSKEAY PDSKYCEKHM  120
HRGKNRSRKP VEMSLATPAP SSNATSANSA TANTTTTSSP APTYHRPAPA AAHDAAPYHA  180
LYGGSPYAAS ARPAGAYHAA AQVSPFHLHL DTTHPQPPPS YYSVDQRDYA YGHAAKEVGE  240
HAFFSDGTTE RDRQAAGQWQ FKNLGVEPKP SATSPFSVGG YGNGAATAYA VDLTKEEDEE  300
ERRRQQQQHC FVLGADLRLE RPSGHDAAPA QKPLRPFFDE WPHEKANKGG SWMGLDGETQ  360
LSMSIPMATN DLPITSRYRN DD*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1847480.0KF184748.1 Saccharum hybrid cultivar R570 clone BAC 035B09 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792586.10.0growth-regulating factor 1
SwissprotQ6AWY81e-170GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A2S3GTQ90.0A0A2S3GTQ9_9POAL; Uncharacterized protein
STRINGPavir.J03212.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-50growth-regulating factor 5