PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A03100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Dof
Protein Properties Length: 292aa    MW: 30581.9 Da    PI: 8.2765
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A03100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.77e-4056116262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++s
  Pahal.A03100.1  56 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRAS 116
                     7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3054110IPR003851Zinc finger, Dof-type
PfamPF027012.8E-3357114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22760114IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MMAGAPPMHI CMDSDWLKGI VPEEPGMGSS SPSAELIACP RPVHAAAADR RLRPQHDQPL  60
KCPRCESTHT KFCYYNNYSL SQPRYFCKTC RRYWTKGGSL RNVPVGGGCR KNKRASAKKP  120
AAPPMLQAHA RQVAAETGLH LSFSGMQQLP PPPAAADPLC SLGLLDWKYD PILAGSGGAA  180
GALDGASSEA HFAGAGMMGI PGGGECHALS ALRYAAGLGE HLQLQGLPFG GRAEHDAVEM  240
KPPAAERLLS LDWYGEASRA PESAISSLGA LGLWSGMIGG AHQHHGSSAA I*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0353260.0BT035326.1 Zea mays full-length cDNA clone ZM_BFb0055G17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826481.10.0dof zinc finger protein DOF5.6-like
TrEMBLA0A2S3GSH10.0A0A2S3GSH1_9POAL; Uncharacterized protein
STRINGSi017962m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.16e-40Dof family protein