PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A03051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 276aa    MW: 30254.3 Da    PI: 8.6307
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A03051.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.19.4e-342680155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWtp+LHerFveav++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Pahal.A03051.1 26 KPRLRWTPDLHERFVEAVTKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 80
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0322383IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-332381IPR009057Homeodomain-like
SuperFamilySSF466899.85E-172682IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-252681IPR006447Myb domain, plants
PfamPF002498.4E-102879IPR001005SANT/Myb domain
PfamPF143793.7E-24125169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MFEGMERAGY GGAAAMGGVV LSRDPKPRLR WTPDLHERFV EAVTKLGGPD KATPKSVLRL  60
MGMKGLTLYH LKSHLQKYRL GKQSKKDTGL EASRGAFAAQ GINFSAPVPP SIPSTAGNNT  120
GETPLADALK YQIEVQRKLH EQLEVQKKLQ MRIEAQGKYL QTILEKAQNN LSYDATGAAN  180
LEATRSQLTD FNLALSGFMD NVSQACEQNN GELAKAMTED NLRASNLGFQ LYHGVHDGED  240
VKCTPDEGLL LLDLNIRGGY DHRSTADLKM NQHMR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-212682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-212682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-212682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-212682157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808925.10.0myb family transcription factor PHL11-like
TrEMBLA0A2S3GSU50.0A0A2S3GSU5_9POAL; Uncharacterized protein
STRINGSi018049m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.16e-66G2-like family protein