PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A03022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 358aa    MW: 38116.8 Da    PI: 8.7432
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A03022.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32175228255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Pahal.A03022.1 175 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 228
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-28173228IPR009057Homeodomain-like
SuperFamilySSF466892.51E-15173229IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23175229IPR006447Myb domain, plants
PfamPF002491.8E-7176227IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MELFPAHPDL QLQISPPPAT KPMELGFWKR ALDAASPAAT TSAAAAATAT TAPSLSFASS  60
APTTTAVGFH AAAGAHHHHQ VPGSHLGLPF LHHTQPILPE GGGGIRDLAS MRPIRGIPVY  120
STTQPLPFLQ SHPHHHHHHP HCYDAIGMGH AGGPRSPKGA LRLAGAPAKR GARAPRMRWT  180
TSLHARFVHA VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTIK TTDHKPASAS  240
SYGQAAAKTI IDIPDDNLFE VTNTTSGSES SAQQSNPDGN EHGSSMCALW SNSSISSRGA  300
WFHDKSIDAT PGDIKSFEDV QSERLDNVSD LNSSPFQVAG MFGRSKKPNL DFTLGRI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-16176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-16176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-16176230357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-16176230357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-16176230357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-16176230357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-16176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-16176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-16176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-16176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-16176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-16176230458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0369111e-130BT036911.1 Zea mays full-length cDNA clone ZM_BFb0147F05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025811921.10.0probable transcription factor KAN2 isoform X1
TrEMBLA0A2S3GSM10.0A0A2S3GSM1_9POAL; Uncharacterized protein
STRINGPavir.Ab02797.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94383445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.17e-38G2-like family protein