PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A02927.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 624aa    MW: 64132.7 Da    PI: 8.8147
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A02927.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.66.5e-912596232374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL e+A a+++gd ++a a La l+  a+p+gd+ qRl+a+++ AL++r+           ++++ ++   +e+ aa +l+++vsP++ ++  
  Pahal.A02927.1 259 RQLLSEAAAAIADGDRAAAAAHLAVLKVAANPRGDAEQRLVAMMAAALSSRIDP--------PSSQQLADLCGAEQRAACQLLHDVSPCFGLALH 345
                     689**************************************************9........34444444448888899**************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      aN aIl+av+g++ +H iDfd+s  +Q +aL++aLas +     l++T+v++p+s      +++l +tg+rL++ A++ g++f+fn+ v+ r  
  Pahal.A02927.1 346 GANLAILDAVAGQRVIHLIDFDVSL-AQHIALIHALASHRVAGTCLKVTAVADPTSPftpaLAQALAATGQRLTRHAQQAGLEFRFNA-VSCRPG 438
                     ***********************98.69**********99999**********9988899999*************************.68899* PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     +++ ++L ++pgEa+aVnl+++l r++desvs +++rde+L+ v+ l P+vv ++eqe+++n++++++rf++a+ +y a+++sl+a+l+ +s +r
  Pahal.A02927.1 439 EVDASRLGCEPGEAVAVNLAFALARVPDESVSPANPRDELLRRVRALGPRVVALAEQELNTNTAPLAARFADACAHYGAVLESLDATLACNSAQR 533
                     *********************************************************************************************** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +  E++ l+ ++ n+va eg +r er+e ++kWr+r+++aG++p+++++ +a+ +k+ l + +  g+ v+ esg l  gW++r ++++SaWr
  Pahal.A02927.1 534 ARAEAA-LAGKAANAVAREGPDRLERCEVFGKWRARFGMAGLRPLAIGQGVADRVKARLGHAS-PGFDVKLESGRLGVGWMGRVVTVASAWR 623
                     ******.888999**********************************************9988.9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.836232604IPR005202Transcription factor GRAS
PfamPF035142.2E-88259623IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MDPARCDPRR GYAYGCGVGS AAQGPPARRQ PRQDAAAVAS GGVLKRSLAE VERWQQALYL  60
RAVRQRVAAQ AAHPPIDVGA VLARAASRGS GFSGPPSGGF AGLSPQPSST LSSLTTASRM  120
VTPPPPMQQL LQRQVVPAPP APLQAAQAVS GGPAARPATA REMVLLQELE KQLLGDDDAG  180
ETEAEGSACG STVTSSAWGS TMKELNSITA APLPSLPMAS ATSNYNSLPV SRSPANSASS  240
STASSTASSS PPTSAASSRQ LLSEAAAAIA DGDRAAAAAH LAVLKVAANP RGDAEQRLVA  300
MMAAALSSRI DPPSSQQLAD LCGAEQRAAC QLLHDVSPCF GLALHGANLA ILDAVAGQRV  360
IHLIDFDVSL AQHIALIHAL ASHRVAGTCL KVTAVADPTS PFTPALAQAL AATGQRLTRH  420
AQQAGLEFRF NAVSCRPGEV DASRLGCEPG EAVAVNLAFA LARVPDESVS PANPRDELLR  480
RVRALGPRVV ALAEQELNTN TAPLAARFAD ACAHYGAVLE SLDATLACNS AQRARAEAAL  540
AGKAANAVAR EGPDRLERCE VFGKWRARFG MAGLRPLAIG QGVADRVKAR LGHASPGFDV  600
KLESGRLGVG WMGRVVTVAS AWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3727362318375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953458.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK3YQT30.0K3YQT3_SETIT; Uncharacterized protein
STRINGSi016627m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.18e-80SCARECROW-like 8