PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A02885.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 305aa    MW: 32804.5 Da    PI: 10.7426
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A02885.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.1e-322477255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    prlrWt+eLH++Fv+av+ LGG++kAtPk il+lm+v gLt++hvkSHLQ+YR+
  Pahal.A02885.1 24 PRLRWTSELHRSFVRAVDCLGGPDKATPKLILQLMDVRGLTIAHVKSHLQMYRS 77
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-302078IPR009057Homeodomain-like
PROSITE profilePS5129411.142080IPR017930Myb domain
SuperFamilySSF466895.91E-162477IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-232477IPR006447Myb domain, plants
PfamPF002492.0E-62576IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGGADGGGRN GGAATRRYNR STVPRLRWTS ELHRSFVRAV DCLGGPDKAT PKLILQLMDV  60
RGLTIAHVKS HLQMYRSSGH DMRKREMQPR LGHLKHSFTI DGGGPKEFFC PPMKRAKAGA  120
EAPATAMHER MQGNSDMGAA GARRCSDDYT QAVPVGSRRI TECPGLPWQR EASAASALQE  180
LGFWVRGTEP FKVRQIGRPI ANRLSPVVRP LSSKEIKCED RCFLFGTATR DEPAKRRSPS  240
QPPASIDPKA AVAAVSSLPS EGSCVLSPPP PSTSFNGCSR PGRGSCLFAG QRINLNLSLS  300
ICGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-172578356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-172578356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-172578356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-172578356Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799208.10.0uncharacterized protein LOC112879085
TrEMBLA0A3L6QKA40.0A0A3L6QKA4_PANMI; Uncharacterized protein
STRINGPavir.Ab02674.1.p1e-180(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.14e-27G2-like family protein