PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A00979.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 510aa    MW: 55783.6 Da    PI: 6.396
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A00979.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-31119172255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Pahal.A00979.2 119 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 172
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.601115175IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-29115173IPR009057Homeodomain-like
SuperFamilySSF466895.02E-14118173IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-22119174IPR006447Myb domain, plants
PfamPF002498.8E-9120171IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MVAREEQVMR ELKDKGVLVE ILDDDEERSI DNKLLDLNEG FDAESEEGEV GDDEEDEGEE  60
GDDGGSTTDV GGSGSSSNNS STNNNSGSKK GDNKGGSKSE GSGEQRVPTV RQYNRSKLPR  120
LRWTPDLHMA FVHAVERLGG QERATPKLVL QMMNVRGLSI AHVKSHLQMY RSKKLDQDGR  180
PRGAITSVYS PMDFHFMRGD RRFHEMSFFQ RAAALSSSKP EHGSFFASRN CSAPELSRLY  240
GLLQHRPAPQ TFDFRNSRNP DWASSQREAV ISRKDVTPPS TAPHQTHPLA APAALRSERR  300
WWPFTDVGAA AATGERRVET GREVGFANSI GSSSRRPHLW AMSVSGDPRL PFRWRPGGSS  360
GRDPVGYPSN SAKITTRASD PVVIDEALDA QQLEKHVEPT RDSATPAYEA CRKRSPPVEA  420
QDGTADLQLS LSPATVVDAK KRKTTAPSEQ EIMDTSELSI SLSLSPPAAA SMQKQQQEKT  480
RRSNDGTGSG EAVLGQSTLD LTMSIRALE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-18120174357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-18120174357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-18120174357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-18120174357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5406071e-61JX540607.1 Paspalum vaginatum clone StvCtg_09077 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824416.10.0uncharacterized protein LOC112899951 isoform X2
TrEMBLA0A2T7F4560.0A0A2T7F456_9POAL; Uncharacterized protein
STRINGSi016955m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-33G2-like family protein