PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A00746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 395aa    MW: 41973.5 Da    PI: 8.2341
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A00746.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.4e-32224279156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     kpr++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Pahal.A00746.1 224 KPRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 279
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.142221281IPR017930Myb domain
SuperFamilySSF466892.65E-17222282IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28223282IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-27224279IPR006447Myb domain, plants
PfamPF002491.7E-6226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MDPPPHSGRR RCREYLLALE EERRKIQVFQ RELPLCLELV TQTIEGMKSR MDGAGGSEET  60
VSDHGPVLEE LMPLKPSLSV SSEEHESSGG AGKREEAAET PDWLRSVQLW SQEPQQRPSS  120
PSSPRKEPLC KPVALSARKA GGAFQPFEKE KRAEAPASSA TTAAASSAAA VVGDSSDDAP  180
ADTDTRERPR SDDKETSRDA EDKGGNKKDS KGGEEGQSQA PARKPRRCWA PELHRRFLQA  240
LQQLGGSHVA TPKQIRELMK VDGLTNDEVK SHLQKYRLHT RRPNATATVQ SAGTSAAPAP  300
PMPQFIVVGG IWVPPPEYAA AAAQPAGGDA PGTTTTAGTV YAPVATLPSG VHRPQPRQQG  360
PPRQSSGCSD AGRRRGDASS GSPAVSSSSH TTSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-14224277255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-14224277255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-14224277255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-14224277255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-14224277255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-14224277255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-14224277255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-14224277255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that may play a role in response to nitrogen. May be involved in a time-dependent signaling for transcriptional regulation of nitrate-responsive genes. Binds specifically to the DNA sequence motif 5'-GAATC-3' or 5'-GAATATTC-3'. Represses the activity of its own promoter trough binding to these motifs.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate. {ECO:0000269|PubMed:23324170}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0355362e-84BT035536.2 Zea mays full-length cDNA clone ZM_BFb0068J14 mRNA, complete cds.
GenBankKJ7268382e-84KJ726838.1 Zea mays clone pUT3378 G2-like transcription factor (GLK5) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025818344.10.0transcription factor NIGT1-like
SwissprotQ6Z8691e-126NIGT1_ORYSJ; Transcription factor NIGT1
TrEMBLA0A2S3GMI50.0A0A2S3GMI5_9POAL; Uncharacterized protein
STRINGPavir.Aa02952.1.p1e-177(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64703754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.13e-41G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Sawaki N, et al.
    A nitrate-inducible GARP family gene encodes an auto-repressible transcriptional repressor in rice.
    Plant Cell Physiol., 2013. 54(4): p. 506-17
    [PMID:23324170]