PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A00247.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 429aa    MW: 47288.6 Da    PI: 6.7018
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A00247.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.38.3e-34249303155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kprlrWt eLHerFveav++LGG+ekAtPk +l+lmkv+gLt++hvkSHLQkYR 
  Pahal.A00247.1 249 KPRLRWTLELHERFVEAVNKLGGPEKATPKGVLKLMKVEGLTIYHVKSHLQKYRF 303
                     79****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.828248306IPR017930Myb domain
SuperFamilySSF466892.33E-17248303IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-31248304IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-25249303IPR006447Myb domain, plants
PfamPF002491.2E-9251302IPR001005SANT/Myb domain
PfamPF143794.6E-22339385IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MDHTCTAPQP SAHSLFRAKS DHCGSAHDPQ SSCASAQSSS VKSEMVGSLS LTKILPLDLH  60
KRSPESNPER SASRASQAQL SDPISSSSST FCTSMFSLKT SSGSCRQKGA LPFLPHPPKC  120
EEQQQQISAR QPSSSSSLLF GADLSNGGHD DAEHSGDLKD FLNLSGDVSE GSFPGESNSM  180
AFSEQMEFQF LSEQLGIAIT NNEESPRLDD IYDRPPQTSS SYSDQENLQS AASLVKVQLS  240
SSRAEVCNKP RLRWTLELHE RFVEAVNKLG GPEKATPKGV LKLMKVEGLT IYHVKSHLQK  300
YRFAKYLPET KEDKKSSSEG KKSQSVIPGN DAGKKKSLQV AEALRMQMEV QKQLHEQLEV  360
QRQLQLRIEE HARYLQKILE QQQKARDSLS TTRNSTKEEA PESTEKEETS SDPLSRRKIS  420
DTDLECNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-26249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-26249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-25249306158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-25249306158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-25249306158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-25249306158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-26249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-26249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-26249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-26249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-26249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-26249306259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR1 and PHR2 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q6YXZ4}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0383171e-127BT038317.1 Zea mays full-length cDNA clone ZM_BFb0227D23 mRNA, complete cds.
GenBankEU9545901e-127EU954590.1 Zea mays clone 1472551 hypothetical protein mRNA, complete cds.
GenBankJX4699781e-127JX469978.1 Zea mays subsp. mays clone UT3338 G2-like transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799346.10.0protein PHOSPHATE STARVATION RESPONSE 3-like
SwissprotA2X0Q01e-177PHR3_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 3
TrEMBLA0A2S3GL330.0A0A2S3GL33_9POAL; Uncharacterized protein
STRINGPavir.Aa03223.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45263769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-59G2-like family protein