PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl017933
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 150aa    MW: 17632 Da    PI: 10.0847
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55339908PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.83e-5561341129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv++yLk+kv+g+++++ ++i+e+d+yk+eP+dLp k ++++++ ewyfF ++d+ky++g+r+nr+tk+gyWk+tgkd++v+s  ++
  Pgl017933   6 LQPGFRFHPTDEELVSYYLKRKVRGQRFDF-NAISEIDLYKFEPRDLPgKsCLQSRDLEWYFFNPKDRKYPNGSRTNRSTKDGYWKTTGKDRPVCS-ASQ 103
                679**************************9.89***************6347778888**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                +vg+kktLv+++grap+ge+t+Wvmheyrle
  Pgl017933 104 TVGMKKTLVYHTGRAPRGERTNWVMHEYRLE 134
                *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-582138IPR003441NAC domain
PROSITE profilePS5100554.0396150IPR003441NAC domain
PfamPF023652.1E-308133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MDQVSLQPGF RFHPTDEELV SYYLKRKVRG QRFDFNAISE IDLYKFEPRD LPGKSCLQSR  60
DLEWYFFNPK DRKYPNGSRT NRSTKDGYWK TTGKDRPVCS ASQTVGMKKT LVYHTGRAPR  120
GERTNWVMHE YRLEGKDLKM SNPAQVISII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-55313312140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root meristem (Ref.1). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270428.11e-67PREDICTED: NAC domain-containing protein 37-like isoform X2
RefseqXP_022893870.18e-68NAC domain-containing protein 86-like isoform X2
SwissprotQ84K006e-64NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA9P1L91e-109A9P1L9_PICSI; Uncharacterized protein
STRINGXP_010694972.17e-67(Beta vulgaris)
STRINGXP_010270427.12e-66(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.14e-67NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]