PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl017808
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 515aa    MW: 58208.7 Da    PI: 4.7002
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55334228PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.13.7e-4961361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                lppGfrFhPtdeel+++yLk k+++     + evi++vd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nrat++gyWkatg+d++++s + 
  Pgl017808   6 LPPGFRFHPTDEELISCYLKGKLNHGLkAAELEVISKVDLYKLEPWDLPeKsFLPSTDMEWYFFSPRDRKYPNGSRTNRATEAGYWKATGRDRKIYS-RA 104
                79********************987763555689**************95344556788**************************************.88 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                +++g+kk   f +grap+ge+tdWvmheyrle
  Pgl017808 105 STIGIKKDSSFLRGRAPQGERTDWVMHEYRLE 136
                99****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-573158IPR003441NAC domain
PROSITE profilePS5100557.7666158IPR003441NAC domain
PfamPF023659.3E-257135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MGTFALPPGF RFHPTDEELI SCYLKGKLNH GLKAAELEVI SKVDLYKLEP WDLPEKSFLP  60
STDMEWYFFS PRDRKYPNGS RTNRATEAGY WKATGRDRKI YSRASTIGIK KDSSFLRGRA  120
PQGERTDWVM HEYRLEENES EAGPCLQNAF VLCRVFKKSG LGEKSGEQYT APVEKGDLSL  180
IKKNLSPGYF GDIEVHSEEQ SKPVEGIDAN SXFTIKNLIE ILNDTTGDSA PLNKWLDILL  240
DDTNSNSSCV ALDEDTIHTQ VDAMPDTPRT QCDSACLPFD ESEFPQIPVN ISFSQYGVPN  300
VSLDAYFEEE RMLDEMLSAA SHDYTNSKAY HSFLGDTFAD ILNGGYIKVK HLLPSMEELE  360
NRDSCLWEVP NPSLHHEGTG IQICSRSPVL QSHKQGILSE GTAARRVRMQ LHKMEDSVER  420
NEKDVNVRHS QNMSNDWYDS KSDSTSCPEM QQLHFDQFDG HKCDSENIRE NEDSVPEALA  480
TYMAGRIDGF ILVTRPYGLC YTLCISGETF LDLGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-48416415171NO APICAL MERISTEM PROTEIN
1ut4_B2e-48416415171NO APICAL MERISTEM PROTEIN
1ut7_A2e-48416415171NO APICAL MERISTEM PROTEIN
1ut7_B2e-48416415171NO APICAL MERISTEM PROTEIN
3swm_A2e-48416418174NAC domain-containing protein 19
3swm_B2e-48416418174NAC domain-containing protein 19
3swm_C2e-48416418174NAC domain-containing protein 19
3swm_D2e-48416418174NAC domain-containing protein 19
3swp_A2e-48416418174NAC domain-containing protein 19
3swp_B2e-48416418174NAC domain-containing protein 19
3swp_C2e-48416418174NAC domain-containing protein 19
3swp_D2e-48416418174NAC domain-containing protein 19
4dul_A2e-48416415171NAC domain-containing protein 19
4dul_B2e-48416415171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.228050.0root| somatic embryo| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LLW80.0B8LLW8_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-73NAC domain containing protein 28