PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl017570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 270aa    MW: 30340.4 Da    PI: 7.0589
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55337647PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.99.8e-50141401128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lp+GfrF+Ptdeel+ +yLkkkv++++++  +vi+e+d+yk++PwdLp+k+  +ekewyfFs+rd++y++g  +nr++ sgyWkatg+dk+++ +++++v
  Pgl017570  14 LPVGFRFEPTDEELLIYYLKKKVSSSPFPG-SVIAEIDLYKHDPWDLPAKAFFGEKEWYFFSPRDREYPNGAPPNRSAGSGYWKATGTDKPIVITSSQKV 112
                79***************************9.99***************8777899********************************************* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk+Lvfykg   +g kt+W+mheyrl
  Pgl017570 113 GVKKSLVFYKGMPLQGLKTNWIMHEYRL 140
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-598164IPR003441NAC domain
PROSITE profilePS5100557.114165IPR003441NAC domain
PfamPF023658.0E-2715140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MEGLAFHQQM LLQLPVGFRF EPTDEELLIY YLKKKVSSSP FPGSVIAEID LYKHDPWDLP  60
AKAFFGEKEW YFFSPRDREY PNGAPPNRSA GSGYWKATGT DKPIVITSSQ KVGVKKSLVF  120
YKGMPLQGLK TNWIMHEYRL AETLPTKRKG SLRLDDWVLC RIYEKVSYSP MIVSCQDVEA  180
LSPDVRRTRQ KSAMPTFSSF SRLLLRDGPF MESLLSHATS DANNAAVSST ESLSSLQDDL  240
PQRNSSEGGS HVSMSLGFNG DEVSSEYPAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-721216715167NO APICAL MERISTEM PROTEIN
1ut4_B2e-721216715167NO APICAL MERISTEM PROTEIN
1ut7_A2e-721216715167NO APICAL MERISTEM PROTEIN
1ut7_B2e-721216715167NO APICAL MERISTEM PROTEIN
3swm_A2e-721216718170NAC domain-containing protein 19
3swm_B2e-721216718170NAC domain-containing protein 19
3swm_C2e-721216718170NAC domain-containing protein 19
3swm_D2e-721216718170NAC domain-containing protein 19
3swp_A2e-721216718170NAC domain-containing protein 19
3swp_B2e-721216718170NAC domain-containing protein 19
3swp_C2e-721216718170NAC domain-containing protein 19
3swp_D2e-721216718170NAC domain-containing protein 19
4dul_A2e-721216715167NAC domain-containing protein 19
4dul_B2e-721216715167NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185191RRTRQKS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.256530.0needle
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during pollen development and maturation. {ECO:0000269|PubMed:21107887}.
UniprotTISSUE SPECIFICITY: Expressed specifically in the tapetum. {ECO:0000269|PubMed:21107887}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013464756.12e-81NAC transcription factor 56
SwissprotQ8GY424e-77NAC25_ARATH; NAC transcription factor 25
TrEMBLD5ABS00.0D5ABS0_PICSI; Uncharacterized protein
STRINGERN033801e-79(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-79NAC domain containing protein 25