PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl017031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family S1Fa-like
Protein Properties Length: 184aa    MW: 20840.9 Da    PI: 10.5027
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55343975PU_refUnigeneView CDS
PUT-175a-Picea_glauca-31147PU_unrefplantGDBView CDS
PUT-175a-Picea_glauca-31252PU_unrefplantGDBView CDS
gnl|UG|Pgl#S55333897PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA122.71.3e-38121184770
       S1FA   7 eakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 
                  +G+nPGlivllvv g+llvf+vgny+ly+yaqk+lPP+kkkPvskkk+kreklkqG+++PGe
  Pgl017031 121 AGRGFNPGLIVLLVVVGVLLVFIVGNYVLYMYAQKTLPPKKKKPVSKKKMKREKLKQGISAPGE 184
                559************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd092722.33E-3014123No hitNo description
PfamPF046891.1E-37121184IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MTLMIESLLH VMFFILGSRP VTWACKKQHA IALSLAEVEY RATINASQEA LWFRQILSDA  60
IKLAKYLVQH QRNKHIELHM HFIRKLIHDL VIEGLLCPTK DQADIDPSAF ASQERLLTKA  120
AGRGFNPGLI VLLVVVGVLL VFIVGNYVLY MYAQKTLPPK KKKPVSKKKM KREKLKQGIS  180
APGE