PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl016977
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 280aa    MW: 31840.8 Da    PI: 4.9241
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55349246PU_refUnigeneView CDS
PUT-175a-Picea_glauca-36635PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.72.4e-1977130356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ +q++ Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Pgl016977  77 KKRRLSVQQVRSLETSFETESKLEPERKMQLAAELGLQPRQVAVWFQNRRARWK 130
                56789************************************************9 PP

2HD-ZIP_I/II128.62.6e-4177167292
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  kkrrls +qv++LE+sFe+e+kLeperK++la eLglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++y+++++e+++Le +v++L++e+ 
    Pgl016977  77 KKRRLSVQQVRSLETSFETESKLEPERKMQLAAELGLQPRQVAVWFQNRRARWKTKQLERDYDDLKQQYEEVVAEKKKLEGQVARLTQEVV 167
                  9**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-1967134IPR009057Homeodomain-like
PROSITE profilePS5007116.89272132IPR001356Homeobox domain
SMARTSM003896.0E-1775136IPR001356Homeobox domain
CDDcd000869.45E-1677133No hitNo description
PfamPF000461.3E-1677130IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-1979139IPR009057Homeodomain-like
PRINTSPR000313.5E-6103112IPR000047Helix-turn-helix motif
PROSITE patternPS000270107130IPR017970Homeobox, conserved site
PRINTSPR000313.5E-6112128IPR000047Helix-turn-helix motif
PfamPF021837.9E-7132164IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
XIYTISMSFN FGSGNDHAVN GFLHLQSGLF SRRFHANGYG HRSGSGFYGS VLYDNPSSSD  60
EVGLCDDEEI SGGLHSKKRR LSVQQVRSLE TSFETESKLE PERKMQLAAE LGLQPRQVAV  120
WFQNRRARWK TKQLERDYDD LKQQYEEVVA EKKKLEGQVA RLTQEVVAAK GEKKDQNTLI  180
TAKSEEENGL QKTTTTTTEE MQSTSPSFCS DADSNRKLLL SSPSCNIQAA ACKTDEENEE  240
ENLQALYSND FHDQLDMYRY LMAAEEQQHH GPDWLNFENL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124132RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.95440.0needle| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ8S7W91e-35HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLA9NYL70.0A9NYL7_PICSI; Uncharacterized protein
STRINGLPERR03G04660.12e-37(Leersia perrieri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.15e-37homeobox 3