PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl016342
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 435aa    MW: 49075.7 Da    PI: 4.6142
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55334800PU_refUnigeneView CDS
PUT-175a-Picea_glauca-31704PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM145.43e-4561361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                lppGfrFhPtdeel+ +yLk k+++    ++ evi++vd+y++ePwdLp k  + +++ +    s+rd+ky++g+r+nrat++gyWkatg+d++v+s   
  Pgl016342   6 LPPGFRFHPTDEELIFNYLKVKLKNGLkASEVEVIPDVDLYRCEPWDLPeKsFLPNTDMDDISXSPRDRKYPNGSRTNRATEAGYWKATGRDRKVYS-LA 104
                79********************998764555689***************43333345557799**********************************.88 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                +++g+kkt vfy+grap+ge+tdWvmheyrle
  Pgl016342 105 STIGIKKTPVFYRGRAPQGERTDWVMHEYRLE 136
                89****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-483172IPR003441NAC domain
PROSITE profilePS5100551.8076172IPR003441NAC domain
PfamPF023654.3E-217135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MGTFALPPGF RFHPTDEELI FNYLKVKLKN GLKASEVEVI PDVDLYRCEP WDLPEKSFLP  60
NTDMDDISXS PRDRKYPNGS RTNRATEAGY WKATGRDRKV YSLASTIGIK KTPVFYRGRA  120
PQGERTDWVM HEYRLEENEC EAGPCLQVPA SWRRVGSSMR KNAFVLCRAL KKSELGIKSG  180
EQYTAPVEKG DLFLTKKNPS PDYFGDIEVH SEDQSKLVEG IDAISNLPSK ILLKILNDTT  240
GDSATVNTWL DLLLDDTDSN SSCVAPDEDT INTQVNAMPD TPTTQPEFAC LPFIESDFPQ  300
IPVDLRFSQY RDPNEGLDAF FEEEKMLEEM FSAASQDYNN SKAYHSSLGD TFSDILNGGY  360
IELKNLIPSI EELDHHDSCL WEVPNSLLDH KGTGIQVSSD SPIFQGHQQG FLFEGIAARR  420
VRMQLHKMED SAEKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-41617315169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.313640.0stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LLW80.0B8LLW8_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-68NAC domain containing protein 28