PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl015998
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 264aa    MW: 30560.4 Da    PI: 8.4249
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55339017PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.3e-1750100656
                S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                +++ eq++ Le+ Fe+++++  e++ +LA++l+L+ rqV vW+qNrRa++k
  Pgl015998  50 RLSVEQTKSLETSFEMESKLGPERKMKLAAELRLESRQVAVWYQNRRARWK 100
                6889**********************************************9 PP

2HD-ZIP_I/II107.31.1e-3447138293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  k +rls eq k+LE+sFe+e+kL perK++la eL+l+ rqvavW+qnrRAR+k+kqlEkdy+ Lk+ y + ++e+++Le ev +L+eel++
    Pgl015998  47 KIKRLSVEQTKSLETSFEMESKLGPERKMKLAAELRLESRQVAVWYQNRRARWKAKQLEKDYHNLKQLYHTAVSEKRKLEWEVLRLTEELHA 138
                  669************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-1731103IPR009057Homeodomain-like
SuperFamilySSF466891.75E-1634104IPR009057Homeodomain-like
PROSITE profilePS5007115.61342102IPR001356Homeobox domain
SMARTSM003895.8E-1344106IPR001356Homeobox domain
CDDcd000861.52E-1146103No hitNo description
PfamPF000467.6E-1550100IPR001356Homeobox domain
PROSITE patternPS00027077100IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MSFGNLDIDL MVKNPASRPV SIQPLYEAGK SGNSYDEIGP DYEKEKKIKR LSVEQTKSLE  60
TSFEMESKLG PERKMKLAAE LRLESRQVAV WYQNRRARWK AKQLEKDYHN LKQLYHTAVS  120
EKRKLEWEVL RLTEELHAMK KSRPGPKEFE QISTSDDNLN DTLMTPIRTT DRPKSNNSCC  180
SDAASKSKVS PTEFDLVIKR KRESPSQKAQ ILQNKLSSAN DHKQTGQQAM DDLTIMSDDF  240
YNYFMVLDHD HQGYSSVCNF DWPN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194102RRARWKAKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NYL73e-33A9NYL7_PICSI; Uncharacterized protein