PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl015909
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 409aa    MW: 43770.3 Da    PI: 9.9231
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55337982PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.72.6e-13323379561
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                kr   +++NR AA ++RqRKk+ +++L+ kv+    eN++L +++ +l++e+ +lk+
  Pgl015909 323 KRKNFLERNRQAALKCRQRKKQWLQNLQAKVEFYGHENDQLTSQVTSLREEIVNLKT 379
                4445579*********************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF117862.3E-1699162IPR021755Transcription factor Aft1, HRA domain
Gene3DG3DSA:1.20.5.1705.6E-22316385No hitNo description
SMARTSM003381.3E-18318383IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.059321384IPR004827Basic-leucine zipper domain
PfamPF001701.5E-10323379IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.06E-19323383No hitNo description
CDDcd146878.60E-30323383No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MPASEVEPAQ RPSSKEQQHI RNQSRSASSE TPSNGSNNKS VNTQPKEQKH HDAEPNPFER  60
SFSGKASGAD SGKQVLPGVA NLTSPSLNLT GVNQAPGGWS SFGSLRNGPL SPAMLLGPSG  120
LGGFDGTLRT GLTPNESSIR TGLTPRGDGI YNMNSPGAAA LFGSNFSTGL TPGGNLNFLS  180
GPGGSNMTEA MFTRPALPQS QLSTVENNSI QMNGNGQDAD AAANGLFLLA QHSQQQQNHN  240
GDLMRKATVN SAKNIESAPN TYGSSSPPSA RRGRRKSSFA EQSPPAEKPA KRGRKQSLKV  300
SDSGNESDDM MDTGRPGETD EEKRKNFLER NRQAALKCRQ RKKQWLQNLQ AKVEFYGHEN  360
DQLTSQVTSL REEIVNLKTM LLAHKDCPVA LNNSLGGIGD MQQLQGVQY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.306520.0needle