PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl015744
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 282aa    MW: 30246.4 Da    PI: 6.8845
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55333407PU_refUnigeneView CDS
PUT-175a-Picea_glauca-32343PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.9e-1088136351
                XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                ++k  +r   NReA r++R++Kka+++ Lee v  L++ N++L  +l+ 
  Pgl015744  88 SSKPKKRPVGNREAVRKYREKKKARTASLEEDVLHLTTLNQQLLRRLQG 136
                5678899999*********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.0E-1385153No hitNo description
SMARTSM003381.7E-986153IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.6888135IPR004827Basic-leucine zipper domain
PfamPF077165.7E-1588143IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.5E-790136No hitNo description
CDDcd146864.05E-1192145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MAGMIDGGDI NFSSNMVDDL GNGSSMESFF EEILRDTTHA CTHTHTCNPP GPDNTHTHTH  60
ASXTHTKILA APDGEKSADT AESPQNSSSK PKKRPVGNRE AVRKYREKKK ARTASLEEDV  120
LHLTTLNQQL LRRLQGQAAL EAEIARLKCL LADFRGRIDG ELGSYPYQKS IRMDKTCNDA  180
PFRQPMPGGY VLDPCNIWCN ADAACHDPTL ASNSEGGVQH ERDSGARWNG ECGQISGHCQ  240
GLKGDMAVTS SGLSACSEGT ATKTVPAAVA SSGKERKGAF GV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.49410.0root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012081777.13e-78PREDICTED: uncharacterized protein LOC105641788 isoform X1
RefseqXP_012081778.13e-78PREDICTED: uncharacterized protein LOC105641788 isoform X2
SwissprotQ8GTS24e-70BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0D6R0G41e-112A0A0D6R0G4_ARACU; Uncharacterized protein
STRINGVIT_03s0038g02420.t011e-73(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.15e-41bZIP family protein