PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl015729
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 701aa    MW: 77804.6 Da    PI: 4.5088
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55349345PU_refUnigeneView CDS
PUT-175a-Picea_glauca-24520PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.6e-55491771129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeel+v+yLk++v g++l+l ++i+evdiyk+ePwdLp k ++++++ ewyfFs++d+ky++g+r+nrat  gyWkatgkd++++s +++
  Pgl015729  49 LPPGFRFHPTDEELIVYYLKRRVCGRSLKL-DAIAEVDIYKCEPWDLPeKsHLQSRDLEWYFFSPKDRKYPNGSRTNRATGIGYWKATGKDRTITS-NSR 146
                79****************************.99**************94346666777**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                +vg+kktLvfy+grap+g++t+Wv+heyrle
  Pgl015729 147 TVGMKKTLVFYTGRAPSGVRTNWVIHEYRLE 177
                *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-6636199IPR003441NAC domain
PROSITE profilePS5100561.49349199IPR003441NAC domain
PfamPF023653.3E-2750176IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
XDIGTGVEEC FVIKVSRVXG IVRDSAEYIH YLVQLFVNMI QASKKRVSLP PGFRFHPTDE  60
ELIVYYLKRR VCGRSLKLDA IAEVDIYKCE PWDLPEKSHL QSRDLEWYFF SPKDRKYPNG  120
SRTNRATGIG YWKATGKDRT ITSNSRTVGM KKTLVFYTGR APSGVRTNWV IHEYRLEDNE  180
LRHSDVVQDS YVLCRLFEKS GPGPKNGEQY GAPFREEDWN EHTNEDGFTL PTVTDASPPA  240
IQLPGGNFDE DNEDISSKQD PVVEDSFVPD QLPFFPDQPI VSSGYSISPD DNDELNRLLL  300
ECLAGPETSS MLQLYHFDDI QKQDDIIPNE SSMCTKMQKE GTEFLSEPED ISLLFNGQHA  360
RAVISQGDGF SLLQQGNMEN KEQMIDSFLQ DIPASSSSLL EGDFLELNDF QSELEANTSG  420
IGSFDELNEF FDASDNLHGF YDASMMLNEI CNPIEGITMG YAENYQYGVL PEASNVYVEP  480
DLAQVGDNLA SQFCTEGQMM DVNGNFFASG EVNDAGILVP PIGGSEYTTV TQHMNAAMLR  540
QQDHNESPPS SLSRFINILG SIDSLPASAA EYPSKKGSLS KQPSFGSIHL RAANAHLTAV  600
TVTCTCSNNL EHKKGDATGS CTCSSDVSYG MMKGSLLANR SVISPVGLKS NISKPSEKTS  660
VRNTRGFIFV FLLGAISALV WLLMLGATVK FGRYLYRLIL S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-59431999168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.6800.0needle| root| somatic embryo| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A482EQA90.0A0A482EQA9_9SPER; NAC transcription factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.12e-86NAC domain containing protein 2