PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl015619
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 424aa    MW: 47731.4 Da    PI: 4.4537
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55346374PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.72.2e-5361361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                lppGfrFhPtdeel+ +yLk k+++     + +vi+evd+y++ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nrat++gyWkatg+d++v+s + 
  Pgl015619   6 LPPGFRFHPTDEELIFNYLKVKLNHGLkAAEVKVIPEVDLYRCEPWDLPeKsFLPNTDMEWYFFSPRDRKYPNGSRTNRATEAGYWKATGRDRKVYS-RA 104
                79********************988763444478**************95334455778**************************************.88 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                ++ g+kktLvfy+grap+ge+tdWvmheyrle
  Pgl015619 105 STLGIKKTLVFYRGRAPQGERTDWVMHEYRLE 136
                99****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-603158IPR003441NAC domain
PROSITE profilePS5100559.7116158IPR003441NAC domain
PfamPF023654.3E-277135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MGTFALPPGF RFHPTDEELI FNYLKVKLNH GLKAAEVKVI PEVDLYRCEP WDLPEKSFLP  60
NTDMEWYFFS PRDRKYPNGS RTNRATEAGY WKATGRDRKV YSRASTLGIK KTLVFYRGRA  120
PQGERTDWVM HEYRLEENEC EAGPCLQNAF VLCRVLKKSE LGVKSGEQYT APVEKGDLSL  180
TKKKPCPDYF GDIEVQSEDQ SKLVEGIGAI SNLPSKFSLR ILNDTTGDSA TVNTSLDILL  240
DDIRSNSSCV APDEDTINTQ VDAMADTPRT QREFACLPFV ESEFSQIPVD LSFSQYGVPN  300
GCLDAFFEEE GMLEEMLSAA SQDYNNSKAY HPSLGDTFAD ILNGGYIELK NLIPSIEDLE  360
HHDSCLWEVP DSLLDHEGTG IQISSDSPIL ESHQQGFLFE GTAAIRVRMQ LHKMEDSAEI  420
NEKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-50415815165NO APICAL MERISTEM PROTEIN
1ut4_B4e-50415815165NO APICAL MERISTEM PROTEIN
1ut7_A4e-50415815165NO APICAL MERISTEM PROTEIN
1ut7_B4e-50415815165NO APICAL MERISTEM PROTEIN
3swm_A5e-50415818168NAC domain-containing protein 19
3swm_B5e-50415818168NAC domain-containing protein 19
3swm_C5e-50415818168NAC domain-containing protein 19
3swm_D5e-50415818168NAC domain-containing protein 19
3swp_A5e-50415818168NAC domain-containing protein 19
3swp_B5e-50415818168NAC domain-containing protein 19
3swp_C5e-50415818168NAC domain-containing protein 19
3swp_D5e-50415818168NAC domain-containing protein 19
4dul_A4e-50415815165NAC domain-containing protein 19
4dul_B4e-50415815165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LLW80.0B8LLW8_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-80NAC domain containing protein 28