PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl014347
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 159aa    MW: 18077.2 Da    PI: 6.5141
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-7949PU_refplantGDBView CDS
gnl|UG|Pgl#S55333204PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.7e-133896563
               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
               ++++r+ +NRe+ArrsR RK++ ++eL+ +++ L aeN  +  + +  + ++ +l+ e+
  Pgl014347 38 RKQKRMLSNRESARRSRMRKQQHLDELRAEAAHLRAENNHMLTKFNIASHKYMQLEEEN 96
               79***************************************999999888888888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-102981No hitNo description
SMARTSM003384.7E-163498IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.763699IPR004827Basic-leucine zipper domain
PfamPF001704.3E-103896IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.22E-123892No hitNo description
CDDcd147021.15E-213990No hitNo description
PROSITE patternPS0003604156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MGLNPSVTSS EPSSQVSGSI PHHYSGSEED PKQTIDERKQ KRMLSNRESA RRSRMRKQQH  60
LDELRAEAAH LRAENNHMLT KFNIASHKYM QLEEENSLLR SYATDLSLKL QSLTIAMQWA  120
GVLNDMDLDS STGFMDTTDI KSCYLPSISQ PLTSTEIYQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15057RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.62440.0cone| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LLW51e-115B8LLW5_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.12e-20basic leucine-zipper 2