PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl014054
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YC
Protein Properties Length: 175aa    MW: 19462.5 Da    PI: 5.7849
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-10288PU_refplantGDBView CDS
gnl|UG|Pgl#S55340190PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC38.62.4e-12821602099
      NF-YC  20 elPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                ++P ar++++++++ d++  s ea  l+ ka e f+ ++ + s+ h  e +++ l     +++v++ + ++fl d vp++
  Pgl014054  82 AFPTARVRRVIRSEGDIRT-SVEATFLINKAAERFLEQFVVDSFEHVLEETKNILSYKPFSSTVANQKRYEFLADFVPEK 160
                79***************85.99*******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-1483159IPR009072Histone-fold
PfamPF008081.6E-683137IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471135.76E-1298160IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MKAANTPKSD TPKSDSSAQS SSDFSEEQEN ADEKTTPTTP TKRPTDNGAY SSLNIEEAET  60
PSRPIRISHH KSPRPETPTT VAFPTARVRR VIRSEGDIRT SVEATFLINK AAERFLEQFV  120
VDSFEHVLEE TKNILSYKPF SSTVANQKRY EFLADFVPEK VKAADALAQR ASAEI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.62420.0cone| needle| root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5ACA91e-123D5ACA9_PICSI; Putative uncharacterized protein
STRINGVIT_06s0004g03030.t013e-23(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.17e-21nuclear factor Y, subunit C10