PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl013039
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 219aa    MW: 25246.1 Da    PI: 4.9545
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-4502PU_refplantGDBView CDS
gnl|UG|Pgl#S55343992PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM99.54.7e-3120100182
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                lppGfrFhP deelv++yL++kv ++++++ ++i+evd++k+ePwdLp k+k +ekewyfFs rd+ky+tg+r+nrat++g+
  Pgl013039  20 LPPGFRFHPMDEELVTYYLTQKVLDSSFSC-RAITEVDLNKCEPWDLPDKAKMGEKEWYFFSLRDRKYPTGTRTNRATEAGI 100
                79****************************.89***************99999**************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-321299IPR003441NAC domain
PROSITE profilePS5100527.03220175IPR003441NAC domain
PfamPF023655.4E-1321103IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MELVNVNSKE QMNKMDDELL PPGFRFHPMD EELVTYYLTQ KVLDSSFSCR AITEVDLNKC  60
EPWDLPDKAK MGEKEWYFFS LRDRKYPTGT RTNRATEAGI HPNSYIYKTQ TDIANDRFKQ  120
CKMEPPSPLF KSSGTLKNLT VQPSSSQWIN TSSGYQHPNQ DNLEPKYGVA QQQMQNQPMV  180
SHSQETGLST EMNAEISSVV SSQRNQPYHE DAQDMDSIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-2820991796NO APICAL MERISTEM PROTEIN
1ut4_B2e-2820991796NO APICAL MERISTEM PROTEIN
1ut7_A2e-2820991796NO APICAL MERISTEM PROTEIN
1ut7_B2e-2820991796NO APICAL MERISTEM PROTEIN
3swm_A2e-2820992099NAC domain-containing protein 19
3swm_B2e-2820992099NAC domain-containing protein 19
3swm_C2e-2820992099NAC domain-containing protein 19
3swm_D2e-2820992099NAC domain-containing protein 19
3swp_A2e-2820992099NAC domain-containing protein 19
3swp_B2e-2820992099NAC domain-containing protein 19
3swp_C2e-2820992099NAC domain-containing protein 19
3swp_D2e-2820992099NAC domain-containing protein 19
4dul_A2e-2820991796NAC domain-containing protein 19
4dul_B2e-2820991796NAC domain-containing protein 19
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.40310.0stem
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15170.11e-48NAC family protein