PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl012351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 248aa    MW: 27671.8 Da    PI: 6.8625
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-38149PU_refplantGDBView CDS
gnl|UG|Pgl#S55337055PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.52.8e-13111169563
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                ++ rr+ +NRe+ArrsR RK++ ++eL+  v+ + +eN++  +  + l++ +++   e+
  Pgl012351 111 RKKRRMLSNRESARRSRMRKQKHLDELRAQVAHMRGENRQILSSFDILTQRYSQALEEN 169
                6789*********************************************9999887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-15107171IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737109172IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-8109161No hitNo description
SuperFamilySSF579591.13E-11111162No hitNo description
PfamPF001701.5E-10111169IPR004827Basic-leucine zipper domain
CDDcd147027.94E-20112163No hitNo description
PROSITE patternPS000360114129IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MQSEQVLLPL SPMISNGSFH MGVVDSRGGQ DFFSRECYES LLNYNNFMSY PPPALNNNNS  60
GSSPEVCKPL SKGGRYIRQD SVASSSHSAQ TACNSASDEA EEQQIGMIDE RKKRRMLSNR  120
ESARRSRMRK QKHLDELRAQ VAHMRGENRQ ILSSFDILTQ RYSQALEENR VLKAQGMELS  180
QQLHQLQQAI AASQSSAAAS PFVLNAFHHN NNNNIINIDE AVDTNTNSLS QCLISCSDNM  240
IPCSDNTI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110131RKKRRMLSNRESARRSRMRKQK
2123130RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.257270.0stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLH9MB623e-65H9MB62_PINRA; Uncharacterized protein (Fragment)
TrEMBLH9WH213e-65H9WH21_PINTA; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-26basic leucine-zipper 42