PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl011479
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 285aa    MW: 31347.5 Da    PI: 7.9069
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-23552PU_refplantGDBView CDS
gnl|UG|Pgl#S55333225PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1222e-383089362
     zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
               +++lkcprCdstntkfCyynnysl+qPr+fCk+CrryWtkGG+lr vPvGgg+rkn k++
  Pgl011479 30 QEILKCPRCDSTNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGSLRSVPVGGGCRKNSKRN 89
               6789****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-241582IPR003851Zinc finger, Dof-type
PfamPF027019.1E-333187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0683387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGVLEGTGDM MDSYPPRQLL DRRLKPQGDQ EILKCPRCDS TNTKFCYYNN YSLTQPRHFC  60
KTCRRYWTKG GSLRSVPVGG GCRKNSKRNN SSNNNGKRSN GEACSSATGS DQLSPSLGGV  120
SNDCKYYNGD GEELIGINYV NSLRQVDHEA AFAGCSINSG VYGIQANDHQ SSQSFQPYHL  180
PTALQSLQGS LIQAPNGFNQ AANRGDLGLV QQQAAGAVSY DREAYHPYIN MSLDHSDGHS  240
RAPQQHKSNN IIENPPDLSA YGLSNINPNS MWRDLTCGEV NPRIW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.58470.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NNI10.0A9NNI1_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-31TARGET OF MONOPTEROS 6