PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl011432
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 287aa    MW: 30304.3 Da    PI: 10.5336
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-12849270PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.97.9e-17205258558
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                +r+rr++kNRe+A rsR+RK+a++ eLe +v eL++eNk+L+k+ ee+ ++ +k
  Pgl011432 205 RRQRRMIKNRESAARSRARKQAYTVELEAEVTELKEENKELRKKQEEMAEMLKK 258
                79****************************************988888887764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.6E-15198258No hitNo description
SMARTSM003381.3E-15201269IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.542203254IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-12205256No hitNo description
CDDcd147073.27E-25205259No hitNo description
PfamPF001701.1E-14205258IPR004827Basic-leucine zipper domain
PROSITE patternPS000360208223IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
AQGTASLSLS PSNNALPSQA VLDAINLEAL KASQQQTGWL NNHYRPSIVQ QQQQQQHQQL  60
LQHQQQQQMA DAAAAAMYAS SVKRQGNGAL MGQGNGALMG QGNGALMGQG NGAFMGSPLG  120
GGLGLSPTMG GGIGNGLQGG LGVGLAGLGA TALTIGAASP ANQLSSDGMG TSHGDNSTVS  180
PIPYGLDVGV RGRKRGGPVE KVVERRQRRM IKNRESAARS RARKQAYTVE LEAEVTELKE  240
ENKELRKKQE EMAEMLKKQI IEMMAPSMSQ HLETKTRALK RTLTGPW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.8721e-164cone
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003603049.14e-59ABA response element-binding factor
SwissprotQ9M7Q42e-44AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A0D6QWI08e-96A0A0D6QWI0_ARACU; Uncharacterized protein
STRINGPOPTR_0002s12710.11e-51(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-17abscisic acid responsive elements-binding factor 2