PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl011052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YC
Protein Properties Length: 303aa    MW: 33904.5 Da    PI: 5.0935
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-22282PU_refplantGDBView CDS
gnl|UG|Pgl#S55347035PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC57.43.3e-186861898
      NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
               ++++P +rikki++aded+ +i+  +P l+sk+ elf+ +l  r++  + +   +t+  s ++++v r ++fdfl +iv +
  Pgl011052  6 DTRFPASRIKKIMQADEDIGKIAQAVPLLVSKSLELFLQDLCDRTYEITLQRGAKTVSASHLKQCVHRYNVFDFLREIVNK 86
               5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.9E-26272IPR009072Histone-fold
SuperFamilySSF471131.62E-20388IPR009072Histone-fold
PfamPF008088.6E-20871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MKKKLDTRFP ASRIKKIMQA DEDIGKIAQA VPLLVSKSLE LFLQDLCDRT YEITLQRGAK  60
TVSASHLKQC VHRYNVFDFL REIVNKVPDM GGSDAATGEE RNGGRRRKAQ EGDENDSDED  120
GVKRARMGAH HGSGRGRGRR GRGRGSRGGR NGITVEKFED EDLDLSSEHS EKQEKASEIF  180
TDVNTETRET KVAVNLGSTP VVRDFDLNME LDESGVVASM PIQPAVKPEH HPSDVANVHV  240
AVKEADELPS DVPIVQHPIK QEEQYPSWSH SEVDNVAIDS MQFHVRSDRI VDQYEDDYDN  300
EDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A4e-21271574Transcription Regulator NC2 alpha chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.16960.0root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023896354.17e-72dr1-associated corepressor-like
TrEMBLA0A0D6R6F93e-82A0A0D6R6F9_ARACU; Uncharacterized protein
STRINGERM990768e-68(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.15e-56nuclear factor Y, subunit C11