PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl010688
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 322aa    MW: 36742.1 Da    PI: 5.8458
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-35140PU_refplantGDBView CDS
gnl|UG|Pgl#S55335320PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.3e-1757107656
                S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                +++  q++ Le+ Fe  ++++  ++ +LAk lgL+ rq++vWFqNrRa++k
  Pgl010688  57 RLSFGQVKMLEKSFELRNKLDPVQKMQLAKALGLQPRQISVWFQNRRARWK 107
                455679********************************************9 PP

2HD-ZIP_I/II117.29.2e-3853145193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekk+rls  qvk+LE+sFe ++kL+p +K++la++Lglqprq+ vWFqnrRAR+ktkqlEkd++aLk++yd+lk++ ++L +++++ ++e+++
    Pgl010688  53 EKKKRLSFGQVKMLEKSFELRNKLDPVQKMQLAKALGLQPRQISVWFQNRRARWKTKQLEKDFDALKQEYDTLKRNYDTLLQQNRQFKAEVQR 145
                  69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.19E-1943111IPR009057Homeodomain-like
PROSITE profilePS5007115.87253109IPR001356Homeobox domain
SMARTSM003894.7E-1553113IPR001356Homeobox domain
CDDcd000861.29E-1454110No hitNo description
PfamPF000467.6E-1557107IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-1857116IPR009057Homeodomain-like
PRINTSPR000311.1E-58089IPR000047Helix-turn-helix motif
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
PRINTSPR000311.1E-589105IPR000047Helix-turn-helix motif
PfamPF021836.0E-11109145IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MAXTAGARSL TRNECENTRK RSMSSYSYSG AVYLSDHDIG EEDGSDECLH FGEKKKRLSF  60
GQVKMLEKSF ELRNKLDPVQ KMQLAKALGL QPRQISVWFQ NRRARWKTKQ LEKDFDALKQ  120
EYDTLKRNYD TLLQQNRQFK AEVQRQGTEL EKNDGSSKVR VSEIEPRKNS ENSVPKVTNS  180
PMELSVKSEI SIKCTEQQRY CKYPMNIQEQ EGECCSIMTE ASSSIFNIDC PRTMEISESP  240
GVPQMAAAAA NRSSPTLVVE GLSTGEQVGA GGLKTPLQGL HEWYCQPKVE VDQITDEETQ  300
CNLFYSFEEQ SAMMLCEYWH AR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101109RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.161090.0root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NQH81e-146A9NQH8_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-42homeobox 3