PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl010493
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 337aa    MW: 37765.8 Da    PI: 9.5162
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-1887PU_refplantGDBView CDS
gnl|UG|Pgl#S55336244PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.54.4e-52141441128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk....k 96 
                lppGfrFhPtdeel+ +yLkkkv++++++  ++i+e+d+yk++PwdLp+k+  +e+ewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk+++ +    +
  Pgl010493  14 LPPGFRFHPTDEELLIHYLKKKVSSSPIPG-SIIAEIDLYKHDPWDLPAKACFGEQEWYFFSPRDRKYPNGERPNRSAGSGYWKATGTDKPIVITsgstS 112
                79****************************.89***************8777899**************************************9978877 PP

        NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                +++vg+kk+Lvfykgr  kg kt+W+mheyrl
  Pgl010493 113 SQKVGVKKSLVFYKGRPLKGLKTNWIMHEYRL 144
                888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6210169IPR003441NAC domain
PROSITE profilePS5100560.59314169IPR003441NAC domain
PfamPF023651.1E-2715144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MDGLAFHEQV LPQLPPGFRF HPTDEELLIH YLKKKVSSSP IPGSIIAEID LYKHDPWDLP  60
AKACFGEQEW YFFSPRDRKY PNGERPNRSA GSGYWKATGT DKPIVITSGS TSSQKVGVKK  120
SLVFYKGRPL KGLKTNWIMH EYRLAETLPT KRKGSLRLDD WVLCRIYKKV SHSPRVVSCP  180
ELEPLSPSPS ATDVQRTRQK SAMPKFGSFS RLLQSEGPSM EDFLSRATSD ANAALSHVEP  240
SSTLQVVPQK LNSSETRSHL SMTMGFNGDE VSSVHPAKRQ NTLNPSSSLQ LQSSNPYMAV  300
AAPDQHMYRL PINESWNPET PTWPLPTGNL WPAYDNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A9e-751417520174NAC domain-containing protein 19
3swm_B9e-751417520174NAC domain-containing protein 19
3swm_C9e-751417520174NAC domain-containing protein 19
3swm_D9e-751417520174NAC domain-containing protein 19
3swp_A9e-751417520174NAC domain-containing protein 19
3swp_B9e-751417520174NAC domain-containing protein 19
3swp_C9e-751417520174NAC domain-containing protein 19
3swp_D9e-751417520174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.248140.0root| vegetative bud
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284654.22e-89PREDICTED: NAC transcription factor 56
TrEMBLD5ABS01e-146D5ABS0_PICSI; Uncharacterized protein
STRINGVIT_19s0014g03300.t019e-89(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.21e-85NAC domain containing protein 47