PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl010281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 354aa    MW: 40939 Da    PI: 5.329
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-9345PU_refplantGDBView CDS
gnl|UG|Pgl#S55349294PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.58.8e-5661331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeelv +yLkkkv+  k+el ++i+evdiyk+ePwdL+ k  + +++ ewyfFs rd+ky++g+r+nrat++gyWkatgkd++v s + +
  Pgl010281   6 LPPGFRFHPTDEELVAYYLKKKVHCWKIEL-DIIPEVDIYKCEPWDLHeKsFMPGRDLEWYFFSARDRKYPNGSRTNRATEAGYWKATGKDRKVSS-HMR 103
                79****************************.99**************84334555777*************************************9.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                ++g+kktLvfy+grap+g++tdWvmheyrl
  Pgl010281 104 QIGMKKTLVFYRGRAPHGSRTDWVMHEYRL 133
                ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-633156IPR003441NAC domain
PROSITE profilePS5100559.8916156IPR003441NAC domain
PfamPF023654.3E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLKKKVHC WKIELDIIPE VDIYKCEPWD LHEKSFMPGR  60
DLEWYFFSAR DRKYPNGSRT NRATEAGYWK ATGKDRKVSS HMRQIGMKKT LVFYRGRAPH  120
GSRTDWVMHE YRLDEKECEA SASLQEAYAL CRVFKKSGPG PKMGEQYGAP VDNDFSCAMG  180
NLFNKNMLSS VKEQSEEKPS PVSQQQVDPT NSREISSEII NDMNGDDAMH KKSLQLLRYG  240
NANCSLASPN EFTKHPKVEP NESSCPSFEV DYFPKNCLNL SESRMPTQYL LGEQIHLSVE  300
EAEILEQIYQ DVKTCQEITY ISQFINSDFE ELQNSEDYIH LDDFVSRCNI EKDH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-54115612165NO APICAL MERISTEM PROTEIN
1ut4_B8e-54115612165NO APICAL MERISTEM PROTEIN
1ut7_A8e-54115612165NO APICAL MERISTEM PROTEIN
1ut7_B8e-54115612165NO APICAL MERISTEM PROTEIN
3swm_A9e-54115615168NAC domain-containing protein 19
3swm_B9e-54115615168NAC domain-containing protein 19
3swm_C9e-54115615168NAC domain-containing protein 19
3swm_D9e-54115615168NAC domain-containing protein 19
3swp_A9e-54115615168NAC domain-containing protein 19
3swp_B9e-54115615168NAC domain-containing protein 19
3swp_C9e-54115615168NAC domain-containing protein 19
3swp_D9e-54115615168NAC domain-containing protein 19
4dul_A8e-54115612165NAC domain-containing protein 19
4dul_B8e-54115612165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.261740.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270697.11e-103PREDICTED: NAC domain-containing protein 45
TrEMBLA0A1U8ARY41e-101A0A1U8ARY4_NELNU; NAC domain-containing protein 45
STRINGXP_010270697.11e-102(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-92NAC domain containing protein 28