PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl010104
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 370aa    MW: 42456.3 Da    PI: 7.3177
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-3119PU_refplantGDBView CDS
gnl|UG|Pgl#S55350286PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.93.9e-53121411129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPt+eel+++yLkkkv+ +k++l +vi++vd++k+ePwdL++  k+ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++ + + 
  Pgl010104  12 VPPGFRFHPTEEELLHYYLKKKVSYEKIDL-DVIRDVDLNKLEPWDLHErcKIGSaPQNEWYFFSHKDKKYPTGSRTNRATAAGFWKATGRDKAIRN-SY 109
                69****************************.9***************862333333556*************************************9.88 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                + +g++ktLvfykgrap+g+ktdW+mheyrle
  Pgl010104 110 KRIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 141
                99****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-598162IPR003441NAC domain
PROSITE profilePS5100557.85612162IPR003441NAC domain
PfamPF023659.9E-2813140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MTSLSVNGSS SVPPGFRFHP TEEELLHYYL KKKVSYEKID LDVIRDVDLN KLEPWDLHER  60
CKIGSAPQNE WYFFSHKDKK YPTGSRTNRA TAAGFWKATG RDKAIRNSYK RIGMRKTLVF  120
YKGRAPHGQK TDWIMHEYRL EDNDNSLHGH EDGWVVCRVF KKKNYLKGHD DNSDPGSSNL  180
DQENSAVLSE PKDCRGHGEV QYSQIQHHHH QQQQLLKHEL AAAGMQYSIL ESHHHDQLMQ  240
MARHLESQKL MNTAACNPPS PVSSGIKRLF PERGIEDGSK RIHYNHELPT GNGNGSSHVE  300
ITTQEQGHLN EIREGQVQLN DWSALDRLVA SHLNQVEESS KEIRYVDAMP SGDHISLPLR  360
SEIDLWNFGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-501116414170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.277110.0root
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detectable in lateral root development when they reach 10 mm long. {ECO:0000269|PubMed:20197506}.
UniprotTISSUE SPECIFICITY: Expressed throughout the root cap, in both columella (COL) and lateral root cap (LRC) cells, with higher levels in the COL-adjoining LRC than the upper LRC. Also present at low levels expression in the tips of cotyledons and the cotyledon vasculature, as weel as in vasculature of the first pair of true leaves and at the hydathodes. {ECO:0000269|PubMed:20197506}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011621045.11e-117protein BEARSKIN2
SwissprotQ9SV871e-102BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A345GNY91e-134A0A345GNY9_CUNLA; NAC transcription factor 1 protein
STRINGERM997621e-117(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-102NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]