PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl009943
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 386aa    MW: 44136.1 Da    PI: 4.5669
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-12925PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-5261361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                lppGfrFhPtdeel+++yLk k+++     + evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g r+nrat++gyWkatg+d+ ++s + 
  Pgl009943   6 LPPGFRFHPTDEELISCYLKGKLNHGLkAAELEVISEVDLYKLEPWDLPeKsFLPSTDMEWYFFSPRDRKYPNGCRTNRATEAGYWKATGRDRIIYS-RA 104
                79********************987763555689**************95344556788**************************************.88 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                +++g+kktLvfy+grap+ge+tdWvmheyrle
  Pgl009943 105 STIGIKKTLVFYRGRAPQGERTDWVMHEYRLE 136
                99****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-563142IPR003441NAC domain
PROSITE profilePS5100556.386150IPR003441NAC domain
PfamPF023655.6E-287135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGTFALPPGF RFHPTDEELI SCYLKGKLNH GLKAAELEVI SEVDLYKLEP WDLPEKSFLP  60
STDMEWYFFS PRDRKYPNGC RTNRATEAGY WKATGRDRII YSRASTIGIK KTLVFYRGRA  120
PQGERTDWVM HEYRLEENES EAGLCLQVDA MPDTPRTQCE SACLPFDESE FPQIPVNISF  180
SQYGVPNGCL DAYFEEERML DEMLSAASQD YSNSKAYRSF IGDTFADILN GGYIEVKNLL  240
PSMEELENHD SCLWEVPNPS LHHEGTGIQI CSRSPVLQSH KQGILSEGTA ARRVCMQLHE  300
MEDSAERNEK DVNVRHSQNM LNDWYDSRSG STSRPEMQQL HFDQFDGQKC DSENIRENED  360
SAPDALATYM AGGIDGRYTR NIFWTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-49613515140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.228050.0root| somatic embryo| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LLW81e-145B8LLW8_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03200.11e-67NAC domain containing protein 45