PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl008828
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YC
Protein Properties Length: 717aa    MW: 79814.4 Da    PI: 9.2373
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-2725PU_refplantGDBView CDS
gnl|UG|Pgl#S55341728PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC158.69.8e-505726658101
      NF-YC   8 kqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                +++e+a+dfk h+lPlarikki+kadedvkmisaeaPv+++kace+fileltlrsw+ +eenkrrtl+k+diaaa+ rtdifdflvdivprde 
  Pgl008828 572 REVEQAQDFKTHSLPLARIKKIMKADEDVKMISAEAPVVFAKACEMFILELTLRSWIYTEENKRRTLQKNDIAAAIGRTDIFDFLVDIVPRDEF 665
                569****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471137.38E-31565656IPR009072Histone-fold
PfamPF008089.9E-21584647IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.4E-36585662IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
XREKDAEKKA QHKRCQSFDS GYGISERENY VSKRAKHASL NETTGVAKKK AEQEEDGKKA  60
YEKKAQEKEE KEDRTKAAEK KVQEKEDGKK DVEKKAQHKR RQSFEPGYGL SERENYASKR  120
AKDASLNETT RVAGGIDNSK ASPYNIDGVQ NKLIMMYGHD HHTSAFSAAN TGLDASLNET  180
TRVAGGIDNS KASPYNIDGV QNKLIMMYGH DHHTSAFSAA NTGLAAGAFA SAPSIAAXIN  240
NERRRHEGYP LAFGTSKSNP YWIIIXIALV SPAGAFAFPL PNVAEVNYEG RGQQSYTMNF  300
GEVNKNHVRT SVYGTGDLAN SFATQSNYNF EGRGEKSYQL NFGEIRNNPV RQSAYVTGVS  360
SATQCHYERR VPELYTSTFG GGNTAGIVSS LYGSNPRTIP SVVNQGTHER SLGQSSGFAG  420
RNMVPAESSG YESGVSTVRP SSVSQDHFER KGSVIDGIDS TVVNFSIPDP LSFLTLMMKT  480
QQDRVICIKG CPLYCNRIKF VFWLNKNFLL GIPNDLIFLQ FHLLYWNTNS ASVGVLPYNN  540
AISFXYFEML KTIFYNXIAW IIMLFKKKNQ MREVEQAQDF KTHSLPLARI KKIMKADEDV  600
KMISAEAPVV FAKACEMFIL ELTLRSWIYT EENKRRTLQK NDIAAAIGRT DIFDFLVDIV  660
PRDEFKDEGL VIPRAAGAVP FMGPGDNVPS YYYVAQQAPN MAAYAPPTQQ MRSKAPX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_B7e-39569662297NF-YC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1634640RRTLQKN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.13410.0needle| root| stem| vegetative bud