PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl008485
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 125aa    MW: 14413.6 Da    PI: 10.5521
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-39108PU_refplantGDBView CDS
gnl|UG|Pgl#S55334194PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.31.5e-193789456
               -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                +++t eq+++Le+ F+  + + a ++eeLA+ lgL  rq+ +WFqNrRak+k
  Pgl008485 37 SRRLTVEQVRALEKSFQLGMILEAGRKEELARALGLHPRQIAIWFQNRRAKWK 89
               3489************************************************9 PP

2HD-ZIP_I/II110.71e-3536125291
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  k rrl+ eqv++LE+sF+    Le  rK+elar+Lgl+prq+a+WFqnrRA++kt qlEkd+ +Lk++y+ lk++ ++L +e+++L++e+
    Pgl008485  36 KSRRLTVEQVRALEKSFQLGMILEAGRKEELARALGLHPRQIAIWFQNRRAKWKTTQLEKDFGVLKQNYEFLKARYHTLLEENKKLQSEV 125
                  88************************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-202393IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-202490IPR009057Homeodomain-like
PROSITE profilePS5007116.6173191IPR001356Homeobox domain
SMARTSM003894.5E-193495IPR001356Homeobox domain
CDDcd000867.90E-153592No hitNo description
PfamPF000461.0E-163789IPR001356Homeobox domain
PRINTSPR000316.8E-76271IPR000047Helix-turn-helix motif
PROSITE patternPS0002706689IPR017970Homeobox, conserved site
PRINTSPR000316.8E-77187IPR000047Helix-turn-helix motif
PfamPF021838.9E-1292125IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MGKTVHSYSA FDISAAGKSI EISSSENVHN AHGMKKSRRL TVEQVRALEK SFQLGMILEA  60
GRKEELARAL GLHPRQIAIW FQNRRAKWKT TQLEKDFGVL KQNYEFLKAR YHTLLEENKK  120
LQSEV
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028808426.13e-34homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8S7W97e-33HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLA0A0D6R0Y66e-36A0A0D6R0Y6_ARACU; Uncharacterized protein
STRINGXP_007153821.14e-33(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-34HD-ZIP family protein