PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl007843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 172aa    MW: 19295.6 Da    PI: 10.0403
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-4218PU_refplantGDBView CDS
gnl|UG|Pgl#S55333470PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.3e-1393149157
                XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                +ke kr +r+ +NR++A+  R+RKka++ eLe+k+ eL+++N++L +++++l++e  
  Pgl007843  93 DKEHKRLKRLLRNRVSAQQARERKKAYLNELETKANELQQKNSELEERVSTLQNENF 149
                5899*************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-1593157IPR004827Basic-leucine zipper domain
PfamPF001709.8E-1294153IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.72595158IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.31E-1397155No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-1697157No hitNo description
CDDcd147041.51E-1798148No hitNo description
PROSITE patternPS000360100115IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MVRRSLKYKM QATAPDFSGS ATGDKLITSS SGDPHEEAMN ECVNESDDDI RRVPEMGVQT  60
GFVVHSDLAV KTESERASAS GGSQRRRGRT PADKEHKRLK RLLRNRVSAQ QARERKKAYL  120
NELETKANEL QQKNSELEER VSTLQNENFM LRQVLKNMTA KNKGGGFVEA EG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.150770.0needle| stem| vegetative bud
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010670652.18e-48PREDICTED: transcription factor HY5
SwissprotQ9SM502e-45HY5_SOLLC; Transcription factor HY5
TrEMBLA9NZF51e-118A9NZF5_PICSI; Putative uncharacterized protein
STRINGPOPTR_0018s01530.12e-44(Populus trichocarpa)
STRINGGSMUA_Achr10P27050_0011e-44(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.12e-35bZIP family protein