PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl007551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 189aa    MW: 21117.8 Da    PI: 8.979
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-37519PU_refplantGDBView CDS
gnl|UG|Pgl#S29739280PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.63.8e-4049109262
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                +++alkcprCds+ntkfCyynnyslsqPr+fCk+C+ryWt+GG+lrnvPvGgg+rknk+++
  Pgl007551  49 PDQALKCPRCDSANTKFCYYNNYSLSQPRHFCKTCKRYWTRGGTLRNVPVGGGCRKNKRAK 109
                6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2846107IPR003851Zinc finger, Dof-type
PfamPF027012.7E-3450107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.41353107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MVLSSVQVCM DSDWPQGVMH ERTLKPLEEI LPACSRPMME QSGLKPPPPD QALKCPRCDS  60
ANTKFCYYNN YSLSQPRHFC KTCKRYWTRG GTLRNVPVGG GCRKNKRAKR TIDHGCAQMN  120
EASTSVHDLN INGSAPLGHS QMTNSMFYGL PTGSAATHDG IHSLSLARRL VDQRALYGND  180
SEFLRTFFX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.226390.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004298945.11e-46PREDICTED: dof zinc finger protein DOF5.6
SwissprotQ9FM032e-36DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLT2B6N62e-55T2B6N6_PINPS; Dof1
TrEMBLT2B7742e-56T2B774_PINPS; Dof6
STRINGGLYMA04G35650.13e-43(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-37Dof family protein