PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl007327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 201aa    MW: 22132.8 Da    PI: 10.0725
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-20034PU_refplantGDBView CDS
gnl|UG|Pgl#S40929944PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.31.6e-131461257
               HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1 12 kNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57
               +NRe+ArrsR+RK+a +  Le  v++L  eN++L k+  e++++++
  Pgl007327  1 SNRESARRSRRRKQAHLNDLEIQVAQLRVENSSLFKRFTEINQKYS 46
               7************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-7154IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-9144No hitNo description
PROSITE profilePS502179.588144IPR004827Basic-leucine zipper domain
PfamPF001701.4E-10146IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-9245No hitNo description
PfamPF124984.3E-1561177IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
SNRESARRSR RRKQAHLNDL EIQVAQLRVE NSSLFKRFTE INQKYSGASV DNRVLKSDVE  60
ALRAKVKMVE SMVPKAATAG FPFQNTSQVQ SAVSLRYTTG IFDSPATNVL QGEDGLYMNT  120
AQSTGTGGSS LSCAISDMNQ QNKELQIQHT GSKMGRTPSM QRVASLEHVQ KRIRGAITCG  180
SMPWGGAWDV DGSQVMEHSE H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1613RRSRRRKQ
2813SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.133120.0needle
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9QWW33e-88A0A0C9QWW3_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_2503_1784 transcribed RNA sequence
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.11e-31bZIP family protein