PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl007322
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 201aa    MW: 22929.7 Da    PI: 9.2349
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-10788PU_refplantGDBView CDS
gnl|UG|Pgl#S25775472PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74e-184094256
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Pgl007322 40 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 94
               778899***********************************************98 PP

2HD-ZIP_I/II129.41.4e-4140129191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq++ LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr+y++l+een+rL+k+ +eLr +l
    Pgl007322  40 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCYETLTEENRRLQKDIQELR-AL 129
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-182694IPR009057Homeodomain-like
SuperFamilySSF466895.99E-193397IPR009057Homeodomain-like
PROSITE profilePS5007117.0863696IPR001356Homeobox domain
SMARTSM003894.9E-1638100IPR001356Homeobox domain
PfamPF000461.6E-154094IPR001356Homeobox domain
CDDcd000862.84E-144097No hitNo description
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
PfamPF021837.9E-1196130IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.4E-2496139IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
HATSAVKRER DGERDNNAND NELDRDCSRG SDEEEGGGTR KKLRLSKEQS AYLEESFKEH  60
NTLNPKQKLA LAKQLNLRPR QVEVWFQNRR ARTKLKQTEV DCEYLKRCYE TLTEENRRLQ  120
KDIQELRALK VAHPSFYMHL PATTLTMCPS CERIASASAP PDSNAKGLHG HGHGYGHGPS  180
PWPTLASAHL RPTRPPPRLE Q
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13844TRKKLRL
28896RRARTKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849539.11e-79homeobox-leucine zipper protein HOX11
RefseqXP_010265939.11e-79PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotA2Z1U12e-77HOX11_ORYSI; Homeobox-leucine zipper protein HOX11
SwissprotQ67UE21e-76HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA9NV751e-145A9NV75_PICSI; Uncharacterized protein
STRINGERN111204e-79(Amborella trichopoda)
STRINGXP_010265939.15e-79(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-64homeobox from Arabidopsis thaliana