PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl006810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 225aa    MW: 25431.5 Da    PI: 8.3128
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55347804PU_refUnigeneView CDS
PUT-175a-Picea_glauca-39602PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.71e-1884138256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++keq   Lee F++n+ ++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  Pgl006810  84 RKKLRLSKEQSALLEESFKENSSLNPKQKQALAKRLNLRPRQVEVWFQNRRARTK 138
                778899***********************************************98 PP

2HD-ZIP_I/II124.45.3e-4084173191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq++lLEesF+e++ L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+ke +eLr +l
    Pgl006810  84 RKKLRLSKEQSALLEESFKENSSLNPKQKQALAKRLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTDENRRLQKELQELR-AL 173
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046186.0E-5234IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.4E-1872138IPR009057Homeodomain-like
SuperFamilySSF466891.88E-1878141IPR009057Homeodomain-like
PROSITE profilePS5007117.49180140IPR001356Homeobox domain
SMARTSM003892.9E-1682144IPR001356Homeobox domain
PfamPF000464.9E-1684138IPR001356Homeobox domain
CDDcd000862.26E-1684141No hitNo description
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PfamPF021835.1E-11140174IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.5E-26140183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
XRRIDVNKLP ASCYYNEDAG TINVSSPNSA LSSFHVDSGG AINAESSCYA MSVKRERDAT  60
DELEADRACS RVSDEEADQE GGTRKKLRLS KEQSALLEES FKENSSLNPK QKQALAKRLN  120
LRPRQVEVWF QNRRARTKLK QTEVDCEFLK RCCESLTDEN RRLQKELQEL RALKLASPLY  180
MQMPAATLTM CPSCERVVPA ENSRPPPFTL AKPQFYPYTH SSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18288TRKKLRL
2132140RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.67020.0root
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021679899.15e-88homeobox-leucine zipper protein HAT22-like
RefseqXP_021679900.15e-88homeobox-leucine zipper protein HAT22-like
SwissprotP466045e-76HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA9NKN41e-162A9NKN4_PICSI; Uncharacterized protein
STRINGXP_010245638.13e-87(Nelumbo nucifera)
STRINGXP_010248307.11e-86(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-78HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]