PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl006189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 253aa    MW: 28269.4 Da    PI: 6.6085
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-5266PU_refplantGDBView CDS
gnl|UG|Pgl#S55342148PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.91.3e-14183226548
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                +r++r++kNRe+A rsR+R++a++ eLe +v +L +eN +L+ke
  Pgl006189 183 RRQKRMIKNRESAARSRARRQAYTNELEIEVNKLIEENARLRKE 226
                79****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.7E-14174227No hitNo description
SMARTSM003383.3E-11179247IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.093181226IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.0E-10183228No hitNo description
PfamPF001704.0E-12183226IPR004827Basic-leucine zipper domain
PROSITE patternPS000360186201IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGSQAVLAPS EFRFLQPLER RVEKLHGGGD AGKTNMGDGL LSSPPCAMQR QVSVAAGGSL  60
DQVWRDIHRP NFQTTQAAAV EDFLAQTGVG QREEEEEEEE ENGLNRGNNS SLTIFAMDSV  120
LAGQNLQHPE WLQFHNQHQQ FGELSAQANS NNDIPLMAAS SGSEHPVWKK RGCESIADHT  180
VERRQKRMIK NRESAARSRA RRQAYTNELE IEVNKLIEEN ARLRKEQAAA DLLHSIQPGQ  240
TKHPLRRTMT APF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.35990.0stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LM160.0B8LM16_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.15e-22ABA-responsive element binding protein 3