PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl005885
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 267aa    MW: 29983.3 Da    PI: 7.032
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-34355PU_refplantGDBView CDS
gnl|UG|Pgl#S55343082PU_unrefUnigeneView CDS
gnl|UG|Pgl#S25767343PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.66.3e-14166224563
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                ++++r+ +NRe+ArrsR RK++ ++eL+  v +L aeN    ++ +  ++++ +++ ++
  Pgl005885 166 RKQKRMLSNRESARRSRMRKQQHMDELRAQVVQLRAENNHILSKFNIASQHYLQVEEQN 224
                799**************************************999999999998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-17162226IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.806164227IPR004827Basic-leucine zipper domain
PfamPF001701.5E-10166222IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.22E-12166218No hitNo description
Gene3DG3DSA:1.20.5.1706.5E-10166223No hitNo description
CDDcd147027.28E-23167217No hitNo description
PROSITE patternPS000360169184IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
DWIDXLVRVE NWEELESLVM LPVLSGSSQT PLISSSAPLE GFSVRNINMN GVGPTLKTSQ  60
QLSSSACFHP PIATAGLTNL QTWENNTRLK LNPSPPSNPA AEISSNSMPP PPPSTKLNLP  120
PCTTNSTGSS SSMTYGFCPP SSSHSGSEEE QQEQQQEQKK NVIDERKQKR MLSNRESARR  180
SRMRKQQHMD ELRAQVVQLR AENNHILSKF NIASQHYLQV EEQNRVLRSQ AIDLYQKLQV  240
LISMQQQQQQ QSLGNFDNLE FQNSGFC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178185RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.73260.0somatic embryo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9S8796e-48A0A0C9S879_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_5460_974 transcribed RNA sequence
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.16e-27basic leucine-zipper 44