PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl005872
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 268aa    MW: 29386 Da    PI: 9.7495
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-7349268PU_refplantGDBView CDS
gnl|UG|Pgl#S55343265PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1506.4e-1662116357
                XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                +lkr rr+ +NRe+ArrsR+RK+a +  Le  v++L  eN +L k+l e+++++ 
  Pgl005872  62 DLKRMRRMLSNRESARRSRRRKQAHLSDLEMQVAQLRVENASLFKRLTEMSQKYN 116
                79******************************************88887777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.8E-1355116No hitNo description
SMARTSM003382.8E-1760124IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.42762116IPR004827Basic-leucine zipper domain
PfamPF001703.9E-1463115IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-1264115No hitNo description
CDDcd147021.22E-665116No hitNo description
PROSITE patternPS0003606782IPR004827Basic-leucine zipper domain
PfamPF124983.4E-20131244IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
YLHGALGHIV SQPIGIPALP PKPQSGASQI KTTTSGSSRE QTDDDELEAE IEANQSTMDP  60
SDLKRMRRML SNRESARRSR RRKQAHLSDL EMQVAQLRVE NASLFKRLTE MSQKYNDAAV  120
DNRILRADVE ALRAKVKMAE DMVARATGVG HSIQNTAQIS QASGMRYMGG PLESPVTSGL  180
QDSSRYSHSG QPISTQGMPC DISNMNDRNK ELLTQNVGTK MGRTPSMQRV ASLEHLQKRI  240
RGGVTCGSTP WSGGWDIEGS PRIENGGQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17683RRSRRRKQ
27883SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.25950.0somatic embryo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236299.15e-68G/HBF-1 protein
RefseqXP_009787496.16e-68PREDICTED: light-inducible protein CPRF2-like
RefseqXP_016450151.16e-68PREDICTED: light-inducible protein CPRF2-like
SwissprotQ990902e-52CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLA9NUK00.0A9NUK0_PICSI; Putative uncharacterized protein
STRINGPGSC0003DMT4000500962e-63(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.28e-43bZIP family protein