PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl005364
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 292aa    MW: 31674.1 Da    PI: 8.3159
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-45718PU_refplantGDBView CDS
gnl|UG|Pgl#S55341294PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.2e-393999262
     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
               +e+alkcprCdstntkfCyynnyslsqPr+fCk+CrryWtkGG+lr vPvGgg+rknk+++
  Pgl005364 39 PEQALKCPRCDSTNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGTLRTVPVGGGCRKNKRAK 99
               7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-293797IPR003851Zinc finger, Dof-type
PfamPF027011.3E-334197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3574397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDSTDWPQGM MQERGFRPSG EDLLSCSRPL LERRLKPQPE QALKCPRCDS TNTKFCYYNN  60
YSLSQPRHFC KTCRRYWTKG GTLRTVPVGG GCRKNKRAKR TVAAEQPMFS TQSEPSTSAT  120
PSASALPIAL DHQTDLNPAT NSSSYFNLPA NSTTGPTEAN LAFARIQQAA RHGGRSVLPN  180
CNNSDFLGLS CGSTTQSSFG PQNSLNSLNP ISSLTNLSAL SALNSLKFSF AGLEDFPVNS  240
NRSDQGSLAV PSEWQIPSES TLFEQAGDST NYWSGGAWGD LTSYGSSISP QI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.54440.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLT2B7740.0T2B774_PINPS; Dof6
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-36TARGET OF MONOPTEROS 6