PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl004960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 309aa    MW: 34757.6 Da    PI: 4.5427
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-1649262PU_refplantGDBView CDS
gnl|UG|Pgl#S27594944PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1887140356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t eq+++Le+ Fe+ +++  e++ +LAk lgL+ rq+ vWFqNrRa++k
  Pgl004960  87 KKRRLTLEQVRALEKNFEMANKLEPEKKMQLAKALGLQPRQIAVWFQNRRARWK 140
                45689************************************************9 PP

2HD-ZIP_I/II127.65.3e-4186177192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ eqv++LE++Fe+ +kLepe+K++la++Lglqprq+avWFqnrRAR+ktkqlEkd+++Lk+ ydalk++ ++L +e+++L++ ++
    Pgl004960  86 EKKRRLTLEQVRALEKNFEMANKLEPEKKMQLAKALGLQPRQIAVWFQNRRARWKTKQLEKDFNVLKQDYDALKQDYDNLMEENNNLQAMIE 177
                  69**************************************************************************************8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575134No hitNo description
SuperFamilySSF466891.71E-1978144IPR009057Homeodomain-like
SMARTSM003893.6E-1785146IPR001356Homeobox domain
PROSITE profilePS5007116.84486142IPR001356Homeobox domain
PfamPF000466.8E-1687140IPR001356Homeobox domain
CDDcd000865.69E-1787143No hitNo description
Gene3DG3DSA:1.10.10.601.9E-1989149IPR009057Homeodomain-like
PRINTSPR000311.7E-5113122IPR000047Helix-turn-helix motif
PROSITE patternPS000270117140IPR017970Homeobox, conserved site
PRINTSPR000311.7E-5122138IPR000047Helix-turn-helix motif
PfamPF021832.9E-13142183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MACDRSALYT SSVIMNTEDN SSAHAIAAMI ASSCTPPATF QGTRSISVFE TGNERKRPAG  60
NSYSALELSD DIGDEDGSDD CIHLGEKKRR LTLEQVRALE KNFEMANKLE PEKKMQLAKA  120
LGLQPRQIAV WFQNRRARWK TKQLEKDFNV LKQDYDALKQ DYDNLMEENN NLQAMIERMS  180
SKSQSCNDQK FQANSSKLQK DDQDLQLLMM SATKVDCADK ENNNEGPSSI GSEGSSVLDM  240
DSPGTIDSQQ NIDSIGFSNV KARDPRLECN FRPKVEENVS QADEPCNYLF YNNLETGPLL  300
WDYNWSSGL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134142RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.62820.0cone| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NV370.0A9NV37_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-42homeobox 3