PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl004893
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 313aa    MW: 35709.8 Da    PI: 4.682
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-25290PU_refplantGDBView CDS
gnl|UG|Pgl#S55333406PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.96.4e-174599256
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +k+++++ +q++ L + Fe ++++  e++ +LA++lgL+ rq+ vWFqNrRa++k
  Pgl004893 45 KKKRRLSLQQVRSLRKTFEVENKLEPERKLQLAQELGLQPRQIAVWFQNRRARWK 99
               677799************************************************9 PP

2HD-ZIP_I/II119.22.3e-3845136192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kkrrls +qv++L ++Fe e+kLeperK +la+eLglqprq+avWFqnrRAR+ktkqlE+dy +Lk +y+ lk++ e++++++++L++el+
    Pgl004893  45 KKKRRLSLQQVRSLRKTFEVENKLEPERKLQLAQELGLQPRQIAVWFQNRRARWKTKQLERDYGQLKLNYECLKSNFEAVKHDNQKLTSELN 136
                  59**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-1927102IPR009057Homeodomain-like
SuperFamilySSF466891.59E-1935103IPR009057Homeodomain-like
PROSITE profilePS5007117.8841101IPR001356Homeobox domain
SMARTSM003897.9E-1644105IPR001356Homeobox domain
CDDcd000861.02E-1545102No hitNo description
PfamPF000462.7E-144599IPR001356Homeobox domain
PRINTSPR000319.3E-67281IPR000047Helix-turn-helix motif
PROSITE patternPS0002707699IPR017970Homeobox, conserved site
PRINTSPR000319.3E-68197IPR000047Helix-turn-helix motif
PfamPF021832.3E-14101141IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MTKMETAEAL KFSIPSPLAG CPGSIHDDDE EEDEEECCAA GQQTKKKRRL SLQQVRSLRK  60
TFEVENKLEP ERKLQLAQEL GLQPRQIAVW FQNRRARWKT KQLERDYGQL KLNYECLKSN  120
FEAVKHDNQK LTSELNYLKE KWEETQKLQS DNTDLSPAKE GNNVSGMVED NPIPDTKSLD  180
RAMVCKQDGD AEIKVTSVAM IFNEKLERSE SESSAIVNEH ADNNNNNSPH SIDSHISTLS  240
LNCYYVPGPP VVSAGDEGLM EALCPRGLIR PKEEQINHHQ DFRADANFVQ EDPACNFFSV  300
DDTTVTLPWW EWP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14448KKKRR
24449KKKRRL
393101RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.250160.0root| vegetative bud
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.11e-34homeobox protein 6