PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl003930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 365aa    MW: 41137.6 Da    PI: 4.772
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-34993PU_refplantGDBView CDS
gnl|UG|Pgl#S55335649PU_unrefUnigeneView CDS
PUT-175a-Picea_glauca-34992PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.85.2e-5071461128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkklelee..........vikevdiykvePwdLp..kkvkaeekewyfFsk.rdkkyatgkrknratksgyWkatg 87 
                lppGfrFhPtdeelv++yL++k+++++ + ++          +i+++d+yk+eP+dL   +++++++++w+fF++ ++kky++g+rknrat+ gyWk+tg
  Pgl003930   7 LPPGFRFHPTDEELVCYYLRRKLSKSTSKSKSksesesvylnAITDIDLYKYEPSDLAarACFQGGDRQWFFFTEgNRKKYPNGSRKNRATEGGYWKTTG 106
                79**********************9995443345667777768**************853488999*******983567899****************** PP

        NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                kd++vls +g+ vg+kktLvf++gr+p+ge+t+Wvmheyrl
  Pgl003930 107 KDRPVLS-RGAIVGMKKTLVFHRGRSPRGERTNWVMHEYRL 146
                *******.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-554170IPR003441NAC domain
PROSITE profilePS5100555.6967170IPR003441NAC domain
PfamPF023654.5E-288146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGDLNYLPPG FRFHPTDEEL VCYYLRRKLS KSTSKSKSKS ESESVYLNAI TDIDLYKYEP  60
SDLAARACFQ GGDRQWFFFT EGNRKKYPNG SRKNRATEGG YWKTTGKDRP VLSRGAIVGM  120
KKTLVFHRGR SPRGERTNWV MHEYRLVDDE AAESSSAGND RFVLCRVFLK SGSSAKPGEQ  180
HGALLSREDS RSTDNQSALV TENKQYYDVM LSPAGEGEVE ERYSPLGPLT AASEERTIPL  240
DDDLSKFLLE CLNEPDNEQT ACDSLQIPAG FDEWSSLIDE PFAEMKGVST LADEADILIR  300
NYTHEHSSAD QKLHTERNVH RVDYMHGADS TEQSNLEALL SPAYFCGDFL ELNDLISPLE  360
SDSFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-46717615174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.106070.0root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the anthers and the upper parts of the stamen filaments after stage 7 to 9 of flower budding. In stage 10 flower buds, expressed in the anthers and pollen grains. Weakly expressed in mature flowers at stage 12. {ECO:0000269|PubMed:24323506}.
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves, shoot apex and stems. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (Ref.6, PubMed:24323506, PubMed:25219309). Promotes reactive oxygen species (ROS) production during drought-induced leaf senescence. In response to abscisic acid (ABA)-mediated drought stress signals, binds directly to the promoters of RBOHC and RBOHE genes, encoding ROS biosynthetic enzymes, resulting in ROS accumulation and triggering leaf senescence via programmed cell death (PCD). ROS-induced leaf senescence sustains plant survival under drought conditions (PubMed:22313226). Involved in heat stress response. Modulates PCD through a ROS-mediated positive feedback control under heat stress conditions. This may provide an adaptation strategy for plant survival under extreme heat stress conditions (PubMed:25219309). Acts as repressor in preventing anther dehiscence during stamen development by suppressing genes that participate in jasmonic acid (JA) biosynthesis, such as DAD1, AOS, AOC3, OPR3 and 4CLL5/OPCL1 (PubMed:24323506). {ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:24323506, ECO:0000269|PubMed:25219309, ECO:0000269|Ref.6}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) (PubMed:22313226, PubMed:25219309). Induced by heat shock (PubMed:25219309). Induced by cold, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:25219309}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694513.14e-63PREDICTED: NAC domain-containing protein 78
SwissprotQ949N02e-59NAC53_ARATH; NAC domain-containing protein 53
TrEMBLB8LPQ00.0B8LPQ0_PICSI; Uncharacterized protein
STRINGXP_010694513.12e-62(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.12e-60NAC domain containing protein 53
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
    Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress.
    Plant Cell, 2014. 26(12): p. 4656-79
    [PMID:25549671]
  4. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  5. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]