PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl003884
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 367aa    MW: 40651.7 Da    PI: 8.4521
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-2777PU_refplantGDBView CDS
gnl|UG|Pgl#S55337808PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.6e-1177120245
                XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                +++k+ rr+++NReAAr+sR+RKka++++Le+   +L++  ++L
  Pgl003884  77 PSDKVLRRLAQNREAARKSRLRKKAYVQQLETSRVKLSQLEQEL 120
                689****************************9777777666544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.5E-870122No hitNo description
SMARTSM003382.8E-876139IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.04878122IPR004827Basic-leucine zipper domain
PfamPF001702.8E-878120IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.71E-780122No hitNo description
CDDcd147082.10E-2180132No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
PfamPF141441.7E-31167241IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MDPQSTQYIS SRRTGGGFDS SSTRQLDMWA DSFKADNSPR TGTSSNMEAD AKVDKSEDAH  60
RGTVVVSRSS DQEANKPSDK VLRRLAQNRE AARKSRLRKK AYVQQLETSR VKLSQLEQEL  120
ERARQQGIYI GGTSGDHISS ANGAANAGAA AFDMEYAHWV EEQNRQISDH RAALTAHVTD  180
IELRILVEGG MAHYDSLFRM KSVAAKADVF HLVSGMWKTP AERCFMWMGG FRPSELLKIL  240
KPQLEPLTEQ QVMSVDNLQH SSQQAEDALS QGMEALQQSL AETSAAGSLG ASNVANYMGH  300
MAMAMGKLGM LENFVHQADN LRQQTLQQMS RILTTRQAAR GLLAMEDYFG RLRALSSLWA  360
ARPREPA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.251650.0needle
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010905948.11e-180PREDICTED: transcription factor TGA4-like isoform X1
SwissprotQ415581e-154HBP1C_WHEAT; Transcription factor HBP-1b(c1) (Fragment)
TrEMBLA0A0D6R5P50.0A0A0D6R5P5_ARACU; Uncharacterized protein
STRINGGSMUA_Achr5P16630_0011e-174(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06950.41e-133bZIP family protein