PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl003453
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 393aa    MW: 44440.8 Da    PI: 6.5693
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-8385PU_refplantGDBView CDS
gnl|UG|Pgl#S55335803PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.44.6e-56161441129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgel 99 
                lppGfrFhPtdeelv++yL +kv +++++   +i+evd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkdkev+++ +++l
  Pgl003453  16 LPPGFRFHPTDEELVSCYLVRKVLDNSFSG-IAIAEVDLNKCEPWDLPVKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDKEVFKAhTDRL 114
                79*************************999.88***************99999****************************************9867788 PP

        NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                +g+kktLvfy+grapkgekt+Wvmheyrle
  Pgl003453 115 IGMKKTLVFYRGRAPKGEKTNWVMHEYRLE 144
                ****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-6310168IPR003441NAC domain
PROSITE profilePS5100559.58516168IPR003441NAC domain
PfamPF023654.6E-2917143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MGSSSRSSGN TGEEGLPPGF RFHPTDEELV SCYLVRKVLD NSFSGIAIAE VDLNKCEPWD  60
LPVKAKMGEK EWYFFSLRDR KYPTGLRTNR ATEAGYWKAT GKDKEVFKAH TDRLIGMKKT  120
LVFYRGRAPK GEKTNWVMHE YRLEGQLSYH QLSKNCKDEW VVCRINHKNS GGKKITPGLI  180
NRNFYSDECL GSHSLPALLE SPTYATRAMH NEETELSDMA NIHLCNNNNI LPNDPQFNLN  240
MRTANPTSCI FSQMSSNGSF SGVPSQMGLP SNPILMALAE QYSVSELNLK QCKMEPSSSG  300
ANNDNSLKIS HEEQWNMGRT RHDQQQQINI ENNGISYTPT METHGIDPQD HTAMCLNPDQ  360
MNPVMFNRET RPYQLDHSAE AAPTLDLDSL WAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-541617420174NAC domain-containing protein 19
3swm_B7e-541617420174NAC domain-containing protein 19
3swm_C7e-541617420174NAC domain-containing protein 19
3swm_D7e-541617420174NAC domain-containing protein 19
3swp_A7e-541617420174NAC domain-containing protein 19
3swp_B7e-541617420174NAC domain-containing protein 19
3swp_C7e-541617420174NAC domain-containing protein 19
3swp_D7e-541617420174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.34090.0vegetative bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at low levels in leaves. {ECO:0000269|PubMed:17098808}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021620729.17e-96NAC domain-containing protein 100-like
SwissprotQ9FLR33e-88NAC79_ARATH; NAC domain-containing protein 79
TrEMBLG8CPZ10.0G8CPZ1_PICAB; NAC-domain containing protein 2
STRINGcassava4.1_010179m3e-95(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.22e-90NAC domain containing protein 80
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]