PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl002487
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 470aa    MW: 52129.8 Da    PI: 6.1215
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-37270PU_refplantGDBView CDS
gnl|UG|Pgl#S55346119PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.93.2e-11263308550
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                kr +r   NR +A+rsR RK+++i eLe+ v +L++e ++L  ++ 
  Pgl002487 263 KRVKRILANRQSAQRSRVRKLQYISELERSVNALQTEVSTLSPQVA 308
                8999*********************************999876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-13259323IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.956261313IPR004827Basic-leucine zipper domain
PfamPF001706.7E-10263310IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-14263314No hitNo description
SuperFamilySSF579595.34E-12263317No hitNo description
CDDcd147033.47E-25264314No hitNo description
PROSITE patternPS000360266281IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MAHHGAGDNS AANWGYTSPS SKLPQLPPKS PSFGIVGPDS NNNNIMYMGW PNFPFQGNSL  60
KHQRTPSVGY LSSHGQPSWI DDLLDSPSEN PAKKGPQHRR SASDSLAFLE TPVTSAPIEE  120
IAEEDEFDCR SAASIPSKGS QDFDRLDEEQ LMSMFADIEP FHKQQNQSNQ SASNHTPAAR  180
STALDNRCSE RQTISENPST PSDHNSINET SMEEKVMTVS GQFKSEPEVQ SVCKGEQPFQ  240
QAVKIEMPTS SSTMELDPNI DPKRVKRILA NRQSAQRSRV RKLQYISELE RSVNALQTEV  300
STLSPQVAYL DHQRVLLNVD NGGLKQRIAA LAQDKLFKDA HCEALKKEVQ RLRQLYQEQQ  360
QQNLQKEVAA PTTGSFDLQQ QQFGKLEHNS SPQMIEQKPD HVSDSSSNLM KSGPGISNHR  420
ENNAANNHTS SGSQMLKGMM TSSCLMGDSN KCLEERMMGG MSPDYMVHNT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.3350.0root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260405.12e-87PREDICTED: basic leucine zipper 61-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.17e-60bZIP family protein